Welcome To Automall Preview : Please inspect the vehicle/s or equipment/s or asset/s before bidding. The inspection can be done by any person on giving Business Card, from Wednesday, 4 February 2015 to the day of bid from 10.00 A.M onwards.The bidders are advised to register in Advance. The registration will start on Friday, 23 January 2015 at 10.00 AM Demonstration of bid : Demonstration of bid will happen on Saturday, 7 February 2015 at 11.00 AM at Automall. Bidder Registrations : Ŷ)RUUHJLVWUDWLRQELGGHUPXVWSHUVRQDOO\SUHVHQWZLWK3$1 Card (Mandatory)along with anyone of the following address Proofs i.e . , Passport or Driving License or Voter's ID or Aadhar Card. Ŷ56'5HIXQGDEOH6HFXULW\'HSRVLWLVPXVWIRUWKH Regisration . A minimum deposit of Rupees Nineteen Thousand Nine Hundred and Ninety Nine Only(19,999/-) or ten percent (10%) of Bid price of the vehicle /equipment / asset, Which ever is higher as RSD has to be made in favour of SAMIL at the time of registration, this deposit is refundable. Ŷ8QVXFFHVVIXOELGGHUVZLOOEHUHIXQGHG56'5HIXQGDEOH Security Deposit) immediately after the closure of the Event. If such refund amount is over and above Rupees Nineteen Thousand Nine Hundred and Ninety Nine Only( 19,999 /-) The same shall be refunded by way of Cheque/ RTGS / DD within seven (7) working days. Ŷ)RUVXFFHVVIXOELGGHUVWKH56'5HIXQGDEOH6HFXULW\ Deposit) will be refunded at the time of vehicle delivery after adjusting receivables if any , from the bidder. If such refund amount is over and above Rupees Nineteen Thousand Nine Hundred and Ninety Nine Only(19,999/-)than the same shall be refunded by way of Cheque /RTGS /DD within seven (7) working days. *ENTRY IS STRICTLY RESTRICTED REGISTERED BIDDER ONLY.* TO THE Venue : Shriram Automall India Ltd 5 Cross,Opp.Vijaya Lakshmi Rice Mill,Near Patancheru Rta Office Indresham Road, Medak Hyderabad TELANGANA Phone No: 011-41414444 Toll Free number:1800 102 4141 [email protected] 1 / 35 Payment : Ŷ$OODFTXLVLWLRQVPDGHE\WKH6XFFHVVIXO%LGGHUDUHVXEMHFW to applicable VAT or sales tax or RTO charges or any other statutory taxes applicable as per law in force, the same are payable by Successfull Bidder over and above the bid Amount. Ŷ6XFFHVVIXOELGGHUKDVWRSD\DPLQLPXPRIWHQSHUFHQW (10%) of the highest bid Amount of the vehicle/ equipment/asset to Seller/Owner on the same day of declaration as successful bidder by the Seller/Owner and balance amount should be paid within seven(7) calendar days from the date of declaration. Ŷ2WKHUZLVHWKHELGWDNHQZLOOQRWEHFRQVLGHUHGDV Successful bidder by the Seller/Owner and RSD deposited will be forfeited automatically. Ŷ$GHOD\HGLQWHUHVW#HLJKWHHQSHUFHQW18 %) will be charged against any amount due and payable by the Successful bidder beyond seven (7) calendar days from the date of the event , subject to a maximum period of fifteen (15) calendar days from the date of declaration as successful bidder by the Seller/Owner. Ŷ'HIDXOWEH\RQGWKHVWLSXODWHGILIWHHQ15)calendar day’s time limit will lead to deal cancellation and forfeiture of RSD paid by the successful bidder and the vehicle / equipment / asset will be re-sold without further information/notice to the successful bidder. Ŷ7KHVXFFHVVIXOELGGHUVVKRXOGFKHFNWKHDSSOLFDEOH RTA regulations relevant to the vehicle/s or equipment/s or asset/s bought.All RTA ,taxes, levies and transfer fees would be payable by successful bidder.Wherever declared or announced while bidding these taxes & fees are payable as per declaration in the catalogue book or/and announce ment made during bidding. Also wherever declared or announced in the bidding,SAMIL is not liable to provide any RTA documents. Ŷ3D\PHQWZLOOEHDVSHU6HOOHU¶V2ZQHU¶GLVFUHWLRQUHVHU ves the right.For other terms & conditions or information, please refer bidder’s book or consult with our office before bidding. Dispatch note/delivery note : Ŷ'LVSDWFKQRWHZRXOGEHLVVXHGLQWKHQDPHRIWKH successful bidder by the Seller/ Owner of the vehicle/ equipment/ asset , after 100% realization of the payment in seller’s/ Owners account. Upon which the vehicle/ equipment / asset will be released by SAMIL / service provider. Relevant RTA documents will be released to the successful bidder within 15 days after realization of payment in seller’s account. Ŷ2QUHFHLSWRIWKH'LVSDWFKQRWHIURPKH6HOOHU2ZQHUDOO bought vehicles or equipment or asset must be removed by the successful bidder within fifteen (15) calendar days from the date of event else storage / parking fees @ Rs. 500/( Rupees Five Hundred ) per day plus applicable taxes per Vehicle or equipment or asset will be applicable. Ŷ,IDVXFFHVVIXOELGGHUVHOOVDQ\RIWKHLWHPVZKLFKKHKDV won in the event to a Third Party,Then it is the responsibility of the successful bidder to issue Dispatch note to the third party. Ŷ5HFHLSWV'LVSDWFKQRWHLVVXHGGXULQJRUDIWHUWKHHYHQW must be verified diligently by the successful bidder and any corrections/modifications/alterations subsequent to the event will not be entertained. Delivery : Ŷ6XFFHVVIXOELGGHUVDUHIXOO\UHVSRQVLEOHIRUWDNLQJ delivery of all Vehicle (s) or Equipment (s) or Asset(s) from Auto Mall after clearing 100 %payment is made in the seller/owner account. Ŷ1RYHKLFOHHTXLSPHQWDVVHWLVSHUPLWWHGWREHUHPRYHG by the Successful bidders until all dues are paid in full and realized by the seller/ Owner and service provider. Ŷ$OOERXJKWYHKLFOHVRUHTXLSPHQW¶VRUDVVHWVPXVWEH removed within 15(fifteen)calendar days from the date of event; else storage / parking fees shall be applicable. 2 / 35 Service Charges : Ŷ7KH6XFFHVVIXOELGGHUZLOOSD\DSUHPLXPRIRIELG amount to the Service Provider.As service charges and the same is not negotiable and is payable by all Successful Bidders . Similarly the Service Provider , when rendering services for the Seller/ Owner, may receive service charge from the Seller / Owner. Ŷ6XFFHVVIXO%LGGHUZLOOEHUHTXLUHGWRSD\RQHSHUFHQW (1%)of the highest bid Amount or Rupees One Thousand (1000/-) whichever is higher, towards the service charges due for the services availed. Service charges shall be paid within seven(7) calendar days from the date of declaration as successful bidder by the Seller plus applicable Service Tax@ 12.36 % on the Service Charge for the services rendered by SAMIL / Service Provider , either by way of Demand Draft or Cash or whatever form the Service Provider deems fit .The Service Charge is not negotiable and is payable on all acquisitions. Terms And Conditions : Ŷ$OOWKHWUDQVDFWLRQVDUHRQUHVHUYHGSULFHEDVLVKRZHYHU Seller / Owner reserves its rights to withdraw any vehicle(s) or equipment or asset, if the Seller does not get the desired / expected bid. Ŷ$OOYHKLFOHVHTXLSPHQWVDQGDVVHWVDUHRIIHUHGRQ³DVLV where is basis ”and it is the bidder’s responsibility to do the physical inspection / due diligence before bidding on any vehicle or equipment or asset . Shriram Automall India Limited takes no guarantee or warranties, expressed or implied, of any kind like standard in respect of safety, pollution or hazardous material, fit for any particular purpose, particulars regarding age, year of manufacturing, model , make or condition , merchantable or financeable etc. Ŷ%LGSULFHGRHVQRWLQFOXGHDQ\VWDWXWRU\WD[SHQGLQJ and applicable RTAfee . All these costs are additionally payable by the successful bidder. Ŷ7KH6XFFHVVIXOELGGHUVDUHGHHPHGWRKDYHSK\VLFDOO\ inspected the vehicle(s) and / or equipment (s) and / or asset (s) before bidding, hence subsequent to Bid , no disputes or bid cancellations request shall be entertained. The inspection can be done by any person on giving his / her business card. Ŷ7RSDUWLFLSDWHLQELGGLQJWKHSDUWLFLSDQWVDUHDGYLVHGWR register in advance by depositing RSD. Ŷ<HDUVRQVRPHLWHPVPD\LQGLFDWHPRGHO\HDUGXULQJ which item was put into service/registered with RTA rather than the year of manufacture . Also Years on some items may indicate model year during which item was sold/invoiced by manufacturer in India. 3 / 35 Ŷ,QVRPHSODFHV\HDULVQRWJLYHQZKLFKLQGLFDWHVWKH information for year of manufacture is not available with service provider.Dispute on this point will not be entertain ed after the declaration of the name of successful bidder. Ŷ6$0,/VHUYLFHSURYLGHUPD\UHPRYHWKHYHKLFOHVRU equipment/s or asset/s from the asset list at any point of time ,including,at the time of bidding ,after bidding and on the realization of bid amount by the Seller / Owner from the bidder . Any disputes related to the Assets/ Documents, post bid, would be dealt by SAMIL and Seller/ Owner as per regulations. Ŷ7KH6HOOHU2ZQHURIWKHYHKLFOHVRUHTXLSPHQWVRU asset /s is prohibited by contract from bidding on their own vehicle/s or equipment/s or asset/s from buying back. Ŷ6$0,/VHUYLFHSURYLGHULVDXWKRUL]HGE\WKH6HOOHU Owner to refuse to accept the bid of any bidder if the bidder is unable to satisfy the terms and conditions of the bid. Ŷ1RSHUVRQVKDOOELGRQDQ\/RWDRIZKLFKKHLVWKH Owner/ Seller;or(b) as agent,or on behalf of or for the benefit of the Owner / Seller. Ŷ2WKHUWHUPVDQGFRQGLWLRQVZLOODSSO\LQFOXGLQJIRU payments at Seller/ Owner’s discretion.Please “Refer the Note for any specific T & C of vehicle in catalogue”. Ŷ7KLVEURFKXUHLVDJXLGHRQO\DQGDQLQYLWDWLRQWRDWWHQG the event. The information contained in the brochure is based upon the information received from the Seller/ Owner and other sources believed to be true and reliable but the accuracy there of is not guaranteed or warranted by SAMIL/service provider.Bidder should inspect the vehicle/s or equipment/s or asset/s,documents before bidding. Ŷ7KLVEURFKXUHLVDQLQYLWDWLRQWRDWWHQGWKHHYHQWQRWDQ offer to sell.The Offer to sell occurs at the time and location of the event by the seller when he offers his vehicle/s or equipment/s or asset/s for bid. Ŷ1ROLDELOLW\LVFDVWRQ6$0,/6HUYLFH3URYLGHUIRU accidents during inspection, On Event day and collection. All visitors to the Event shall be held liable for damages that they ause, irrespective of its nature. They shall also be liable for any accidents, damag to buildings, assets,third party articles, etc. Ŷ$ELGGHUZKRELGVDWWKHHYHQWRQEHKDOIRIDQRWKHUSDUW\ shall be liable as a principal in addition to the other party. Ŷ3OHDVHQRWHWKDW6$0,/VHUYLFHSURYLGHUKDVQRW investigated the genuineness or validity of documents available with Seller/ Owner. Bidders should inspect the documents prior to attending the event. Ŷ6$0,/VHUYLFHSURYLGHUUHVHUYHVWKHULJKWWRFRQILVFDWH the Bidders catalogueof bidders who have unruly behaviour or are causing a rigged bidding before and during the bidding process. Ŷ:KHUHVLPLODUORWVDUHLQGLFDWHGLQWKHFDWDORJXH SAMIL/service provider may offer the bidder a choice.This allows the successful bidder to choose all or any of the items in a given lot in a given run, on a per lot basis taken either in or out of sequence. Ŷ3OHDVHQRWHWKLVHYHQWLVUHFRUGHGDQG6$0,/VHUYLFH provider reserve the right to use the recordings to assist with resolving disputes or legal issues as appropriate. Ŷ3OHDVHQRWHWKDWRXU%URFKXUHVDUHSULQWHGSULRUWRWKH event and may contain only a partial list of vehicles /equipments/assets and it may not include the significant number of vehicles / equipments / assets available in the event. Ŷ$OOSKRWRJUDSKVLQEURFKXUHVFDWDORJXHVRUGLVSOD\DUHIRU illustration purpose only. Bidder should physically inspect the vehicle / equipment / asset , documents to their satisfaction before bidding. 4 / 35 Bidding Guidelines : 1. These conditions together with those set out in the details available in the catalogue and in the Service Agreement are the terms and conditions subject to which Shriram Automall India Ltd (SAMIL) , (“the Service Provider / Facilitator”) will facilitate bidding of vehicles/ equipmenton behalf of the Owner / Seller to the successful bidder (“the Bidder”) and all other conditions whether expressed, or implied at common law or by statute as are capable of lawful exclusions are hereby excluded. 2. The Service Provider may at its discretion or upon the instruction of the Owner / Seller: (a)Alter or withdraw all or any lots referred to in this catalogue up to the moment at which the hammer falls(Final Successful Bidder is declared) in relation to such lot(s). (b)Where a reserved bid price has been placed on any lot, the Service Provider may withdraw that lot in the event thatthe highest bid price does not meet the reserved price. (c)Where two or more consecutive lots are similar in quantity and description,offer a choice on any subsequent lots to the bidder at the same price. (d)Bid for any lot or lots offered for bid at the Event. 3. The Bidder,whether acting as principal,agent,officer or director of a company or otherwise , in any capacity whatsoever, and the company he represents, both jointly and severally agree: a. To indemnify and save harmless the Service Providers and the Seller / Owner from any and all actions, causes of action, suits, damages, costs and losses of any nature, arising from the bid or use of any item,or the attendance or participation of Bidder, his agents or employees, at the event of bid and/or at the yard whether before, during or after the event of bid; b. That all rights and defences available to the Service Providers hereunder shall extend to the Seller/Owner. 4. Each vehicle/equipment offered in bidding shall be sold to the highest Bidder and in the event of any dispute arising between bidders such disputes shall be dealt with in such manner as the Service Provider may in its absolute discretion deem fit and proper to determine. 5. If the successful bidder fails to comply with any of the foregoing requirements, the vehicle/equipment/asset(s) which have been successfully bided by him or any part there of may be reoffered for bid, destroyed or otherwise disposed off by the Service Provider in any manner as it shall in its absolute discretion deemfit and any deposits paid by the bidder shall be forfeited. 6. Without prejudice to any claims that the Service Provider may have against the bidder for breach of contract or Other wise, the bidder will be liable from the expiry fifteen (15) days from date of event for all storage, security and administration expenses and the cost of incidental to reselling and / or otherwise disposing of unclear assets/ items. 7. The Bidderhereby agrees that he has satisfied himself and is not relying on the ServiceProviders,nor are Service Providers liable,for any matter in respect of the above.The Bidder further agrees to repair, at his own cost any lot bought at the event to a safe operating condition and, without limitation, to a condition which meets any standard or requirement of any applicable authority , law or regulation including those concerning any use to which the vehicle/ equipment/asset may be put. 8. Any dispute arisingas to any bidding shall be settled by Service Providers and the Owner/Seller at their Discretion and Service Providers may put the lot in dispute up for bid again. The Service Providers reserve the right to refuse any bid which they consider to be an insignificant advance over the preceding bid. 9. The vehicle/equipment/asset bought by the successful bidder become the responsibility of and shall be at the risk of the successful bidder upon acceptance of his bid.It shall 5 / 35 be the responsibility of the successful bidder to insure his acquisitions immediately. The Service Providers shall not be responsible for loss or damage to any vehicle/ equipment/asset bought successfully in the bid. 10. The successful bidder will remove the vehicles/ equipments/asset from Service Provider’s stock yard by his own arrangement and prior intimation shall be provide to the Service Provider subject to the super vision of Service Provider’s authorized representative. 11. If, in the opinion of the Service Provider, the removal of any vehicle/equipment/asset or part there of is likely to cause damages to the premises or result in any other damage which the Successful bidder is either unable or unwilling to rectify, the Service Provider may by notice to the successful bidder rescind the sale of such vehicle/ equipment/asset or permit the removal of such vehicle/ equipment / asset from the premises subject to such other conditions as it may think fit.The decision of the Service Provider shall be final. 12. Should any party clai possession of title to all or part of a vehicle/equipment/asset prior to its removal from the premises , the Service Provider reserves the right to rescind the bid thereof or to permit the removal there of from the premises subject to such condition as it may deem fit. 13. The Successful bidder will be responsible for all damages that the Successful bidder/ its carriers or its agents may do to the property of any third party in removing the vehicle/ equipment /asset (s) it has bought. Should the Service Provider consider that such damage is likely to occur, it may require the Successful bidder to deposit such security money with Service Provider, for the costs of reinstating that part of premises likely to be damaged by the removal of the vehicle/equipment/asset, as the Service Provider may require. Should the bidder refuse to deposit such amount , the Service Provider may refuse the bidder to have access for collecting all or any of the vehicles/equipments/assets it has bought or rescind the id of such vehicle/equipment. 14. The successful bidder is at his own risk once the hammer falls and it is strongly advised to effect insurance at once. Upon the fall of hammer , the successful bidder shall assume all risks in and relating to such vehicles/ equipments/assets. Thesuccessful bidder is advised to effect in respect of all such risks arising thereafter any insurance it may consider necessary. The duty of Service Provider and/or to deliver the vehicles/equipments/assets shall be deemed to have been performed upon the fall of the hammer and in the event of any damage, loss /theft/fire either partial or total, occurs subsequent to the fall of hammer, Service Provider is not liable whatsoever. 15. The vehicle/equipment shall not pass to the successful bidder unless full paymentthere of has been made to the Seller / Owner. The payments through Cheques /DD are subject to realization. 16. The Service Provider shall not be liable in respect of any claim whether in contract or tort, by the bidder arising out of or in any way connected with the bid of all or any goods. 17. All goods are vended as per the specifications shown in the catalogues.Service Provider has used its reasonable endeavours to ensure that the descriptions of each vehicle /equipment/assets match the specifications in the catalogue and the bidder relies upon such description to bid for the vehicle /equipment / assets in “as is where is condition” at his own risk. Bidders should satisfy them selves prior to the bid as to the condition of the vehicle/ equipment /assets and should exercise and rely on their judgment as to whether the vehicle/equipment accords/ corresponds with its description.The vehicle /assets equipment /vended in this event are used unless specifically mentioned as Unused .Subject to the conditions of bid , the bidder can neither hold Service Provider nor its executives responsible/liable for errorsof description or for the genuineness or authority of any vehicle/equipment /asset and no warranty whatsoever is given by Service Provider /its executives to the bidder in respect of any vehicle/equipment/asset and any expressed or implied conditions or warranties are hereby excluded. 6 / 35 18. Service Provider here by severally excludes liability for any accident or injury, howsoever arising or sustained by any person or persons who may be present at the premises during the event, inspection , purchase, collection or any other activity related to the said event. 19. Delivery of Vehicle / Equipment / asset[s] bought by the successful bidder(which shall be at the sole expense of the successful bidder) will not be permitted after normal business hours and on national holidays and request by the successful bidder is to be made within reasonable business hours followed by payment in full of the service tax and other dues due to the Service Provider.(“ Reason able Business hours ” will depend on the natur e and circumstances of each case). Without prejudice to the generality of the foregoing, any suspension or failure of material services resulting from civil commotion, strike or other industrial action or other impediment etc., impairing the normal delivery, is outside the control of the Service Provider. 20. The Service Provider shall not be required to incur any expenses or put in funds towards overcoming such impe diment and to meet such expenses unless , indemnified there from by the successful bidder.The Service Provider shall not be obliged to take any legal proceedings for the removal of any such aforesaid impediment,to the delivery of vehicle/equipments/assets which might in its own judg ment exacerbate the matter or be detrimental to its own reputation or goodwill. 21. The bidder must comply with all current legislation and regulations in relation to the removal / disposal of waste including hazardous waste and may be required to satisfy Service Provider in relation to their disposal / removal procedures. The removal/ disposal of waste materials and other incidental work must be undertaken by an approved and licensed contractor. 22. Where the successful bidder loads any item of plant, machinery or equipment contained in a vehicle/ equipment / asset to remove it from the site , Service Provider shall be under no liability whatsoever to the successful bidder or any third party for any such damage however so caused by the removal and the successful bidder shall be responsible for and indemnify Service Provider against any damage or loss which Service Provider may sufferor incur in respect of loss, damage or injury suffered by the bidder or any third party arising from the removal of vehicle , plant , machinery or equipment. The successful bidder shall indemnify Service Provider against any loss whether through breakage rust, decay,desiccation,leakage wastage, inherent or latent defect or natural deterioration. 23. The successful bidder acknowledges that any software or intellectual property right attached to any vehicle/ equipment/asset may not be the property of the Seller/ Owner or capable of transfer by the Seller / Owner and the service provider is in no way authorizing the use of such software, intellectual property rights by the success ful customer and any use of such software or exploitation of such intellectual property rights shall be at the bidders sole risk. 24. These terms and conditions shall be governed by and construed in accordance with the laws of India. Arbitration : All disputes , differences and/or claims arising out of this event and services rendered there under shall be settled by arbitration in accordance with the provisions of Arbitration and Conciliation Act 1996 or any statutory amendments there of and shall be referred to the sole arbitration of an arbitrator nominated and appointed by the Service Provider .The award passed by such an arbitrator shall be final and binding on all the parties. 7 / 35 In the event of such an arbitrator to whom the matter has been so referred,dies or becomes unable to act as an arbitrator for any reasons including refusal and or resignation or becoming incapacitated due to health problems both mental and or physical or does not passes award with a reasonable period , Service Provider,shall appoint a new person to act as an arbitrator.Such a person shall be entitled to proceed with the reference from the stage at which it was left by his or her predecessor. The venue of arbitration shall be Chennai and the language of arbitration proceedings shall be English. 8 / 35 Sale Order (Movable Items) SI.No ITEMS LOTNO 1 AUTOMOBILE 1-6 2 MULTIUTILITY 7 3 MINI BUS 8-11 4 PICKUP 12-15 5 LGV CARGOTRUCK 16-19 6 TRACTOR 20-25 Sale Order (Immovable Items) SI.No ITEMS LOTNO 1 AUTOMOBILE 26-42 2 MULTIUTILITY 43-55 3 MINI BUS 56-77 4 PICKUP 78-90 5 HGV CARGOTRUCK 91-105 6 LGV CARGOTRUCK 106-119 7 LOADER BACKHOE 120 8 TRACTOR 121-124 9 / 35 1 2010 TATA INDICA VISTA AQUA 1.4 TDI AP26AJ4587 Chasis No : MAT608533APK81200 Tax : Life Time Fuel Type Insurance : Diesel : Not Available RTA Permit C/W Notes : : : : FC : Not Available RC : FRC Rangareddy Not Applicable M/T Not Applicable 2 2008 TATA INDICA V2 DLS AP26AB4870 Chasis No : 600149GRZP94694 Tax : Life Time Fuel Type Insurance : Diesel : 20/01/2016 RTA Permit C/W Notes : : : : FC : Not Available RC : FRC Mahaboobnagar Not Available M/T Not Applicable 3 2008 TATA INDICAB DLE AP09TV9512 Chasis No : 600137GRZP98262 Tax : Life Time Fuel Type Insurance : Diesel : Not Available RTA Permit C/W Notes : : : : FC : Not Available RC : Original Khairtabad Not Surrendered M/T Not Applicable 4 2007 TATA INDICA DLX AP09BM2347 Chasis No : 605121JSZPC7857 Tax : Life Time Fuel Type Insurance : Diesel : 21/12/2015 FC : Not Available RC : FRC RTA : Mahaboobnagar Permit : Not Applicable C/W : M/T Notes : AS PER RTA--TATA MOTORS LIMITED-INDICA TURBO DLG-V2 HVAC,P.S.,F.P.W.,C.L.BS3 5 2002 MARUTI ZEN LXI AP09AP8757 Chasis No : MA3FYG51S00673335 Tax : Life Time Fuel Type Insurance : Diesel : Not Available RTA Permit C/W Notes : : : : FC : Not Available RC : Original Nizamabad Surrendered M/T MARUTI ZEN D * SAMIL make no guarantees or warranties expressed or implied * Shriram Automall India Ltd. This document contains confidential proprietary information and is intended solely for the use of Shriram Automall India Ltd. Any Unauthorized use is strictly prohibited This Catalogue was created on 2/6/2015 please check for most accurate and uptodate information with our office Lot Num Shriram Automall India Ltd. 6 2000 MARUTI ZEN LXI AP11H9771 Chasis No : MA3FYG51S00507620 Tax : Life Time Fuel Type Insurance : Diesel : Not Available RTA Permit C/W Notes : : : : FC : Not Available RC : Original Rangareddy Not Applicable M/T AS PER VEHICLE IS ZEN D 7 2001 TOYOTA QUALLS 2.4D FS AP16AB5499 Chasis No : LF501026430 Tax : Life Time Fuel Type Insurance : Diesel : Not Available RTA Permit C/W Notes : : : : FC : Not Available RC : Original Khammam Not Applicable M/T Not Applicable 8 2009 TATA WINGER STD AP09TA4171 Chasis No : MAT4600629UH03995 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : 01/11/2013 RTA Permit C/W Notes : : : : FC : 03/02/2014 RC : Original Rangareddy Surrendered M/T A/C,FITNESS UP TO:2/7/2015 9 2007 TATA WINGER CARGO VAN AP22W5971 Chasis No : 460001MSZU02181 Tax Paid Upto : 31/03/2015 Fuel Type Insurance : Diesel : Not Available RTA Permit C/W Notes : : : : FC : 24/04/2015 RC : Original Mahaboobnagar Surrendered M/T Not Applicable 10 2009 TATA MAGIC 4X2 MINI BUS AP25TV0971 Chasis No : MAT4451219VG19060 Tax : Life Time Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : Original RTA : Rangareddy Permit : Surrendered C/W : M/T Notes : F-28,29,30 WILL BE GIVEN 10-15 DAYS AFTER SALE AMOUNT COLLECTED ONLY 11 2006 MARUTI OMNI 8 SEATER AP03S3524 Chasis No : 835735 Tax : Life Time Fuel Type Insurance : Petrol : Not Available RTA Permit C/W Notes : : : : FC : Not Available RC : Original Hyderabad Not Available M/T Not Applicable * Please inspect equipment before buying * 11 / 35 Lot Num Shriram Automall India Ltd. 12 2013 TATA SUPER ACE 4X2 PICKUP AP23X7077 Chasis No : MAT483139DYD13434 Tax Paid Upto : 30/09/2013 Fuel Type Insurance : Diesel : Not Available RTA Permit C/W Notes : : : : FC : 27/09/2015 RC : Original Siddipet Not Applicable Spring suspension Not Applicable 13 2012 TATA SUPER ACE 4X2 PICKUP AP29V9711 Chasis No : MAT483139CYH21561 Tax Paid Upto : 31/12/2013 Fuel Type Insurance : Diesel : Not Available RTA Permit C/W Notes : : : : FC : Not Available RC : Original Rangareddy Not Available Spring suspension Not Applicable 14 2012 TATA ACE HT 4X2 PICKUP AP22Y8512 Chasis No : MAT445056CZD38114 Tax Paid Upto : 31/03/2015 Fuel Type Insurance : Diesel : 21/05/2015 RTA Permit C/W Notes : : : : FC : Not Available RC : FRC Mahaboobnagar Not Available Spring Suspension Not Applicable 15 2011 TATA ACE EX 4X2 PICKUP AP28TC6920 Chasis No : MAT445222BZJ85126 Tax Paid Upto : 31/03/2015 Fuel Type Insurance : Diesel : 26/10/2015 RTA Permit C/W Notes : : : : FC : Not Available RC : Original Rangareddy Not Applicable Spring suspension Not Applicable 16 2006 EICHER 11.10 4X2 CARGO TRUCK AP05W6737 Chasis No : 33GC6G013746 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : 15/12/2015 RTA Permit C/W Notes : : : : FC : Not Available RC : FRC Bahadurpura Not Available Spring Suspension Not Applicable 17 2005 EICHER 11.10 4X2 CARGO TRUCK AP28TA9297 Chasis No : 20GC5C006872 Tax Paid Upto : 30/09/2014 Fuel Type Insurance : Diesel : 15/07/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : spring susp Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer * Insurance and removal is buyer`s responsibility * 12 / 35 Lot Num Shriram Automall India Ltd. 18 2005 EICHER 10.95 4X2 CARGO TRUCK AP28TA3686 Chasis No : 29HC5A115250 Tax Paid Upto : 31/03/2015 Fuel Type Insurance : Diesel : 01/10/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : Spring Suspension Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 19 2003 EICHER 10.90 4X2 CARGO TRUCK AP04U7833 Chasis No : 17EC31199037 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : Not Available RTA Permit C/W Notes : : : : FC : Not Available RC : Original Rangareddy Surrendered spring susp length 14.3 width 6.9 Not Applicable 20 2009 JOHNDEERE 5310 AGRICULTURE TRACTOR AP37AU3373 Chasis No : PY5310S041984 Tax Paid Upto : 31/03/2015 Fuel Type Insurance : Diesel : 01/10/2015 RTA Permit C/W Notes : : : : FC : Not Available RC : Original Sangareddy Not Applicable 4 cylinder Not Applicable 21 2004 EICHER 380 AGRICULTURE TRACTOR AP07R6992 Chasis No : 910313138968 Tax Paid Upto : 31/03/2015 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : Original RTA : Siddipet Permit : Not Applicable C/W : 4CYLINDERS Notes : Forms 28,29,30,35 will be issued on 25-30 days after payment collected 22 2006 EICHER 380 AGRICULTURE TRACTOR AP07AF7909 Chasis No : 912713178831 Tax : Not Available Fuel Type Insurance : Diesel : 24/01/2015 FC : Not Available RC : Original RTA : Siddipet Permit : Not Applicable C/W : 4CYLINDERS Notes : Forms 28,29,30,35 will be issued on 25-30 days after payment collected * Every item sold on "AS IS WHERE IS" basis * 13 / 35 Lot Num Shriram Automall India Ltd. 23 2006 EICHER 242 AGRICULTURE TRACTOR AP23W3527 Chasis No : 912610276613 Tax Paid Upto : 30/06/2013 Fuel Type Insurance : Diesel : Not Available RTA Permit C/W Notes : : : : FC : Not Available RC : Original Sangareddy Not Available 3 cylinder Not Applicable 24 2008 NEWHOLLAND 3600 AGRICULTURE TRACTOR AP23P1361 Chasis No : 791856 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : Original RTA : Sangareddy Permit : Not Applicable C/W : Not Available Notes : Forms 28,29,30,35 will be issued on 25-30 days after payment collected 25 2005 SWARAJMAZDA SAMRAT ZT 54 4X2 CARGO TRUCK AP29T7796 Chasis No : PGZGL4GM0096375 Tax Paid Upto : 30/06/2014 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : SPRING SUSP Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 26 2012 TATA INDICA V2 LE AP28TV6398 Chasis No : MAT600140CPE34408 Tax : Life Time Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 27 2009 TATA INDICAB DLE AP09TVA1316 Chasis No : MAT6001379PN92480 Tax Paid Upto : 30/06/2012 Fuel Type Insurance : Diesel : 31/03/2015 FC : Not Available RC : RTO Forms RTA : Khairtabad Permit : Not Surrendered C/W : M/T Notes : form 26,28,29,30,35 will be given with in 25-30 days after sale amount received,any rta related work will be done by customer only * SAMIL make no guarantees or warranties expressed or implied * 14 / 35 Lot Num Shriram Automall India Ltd. 28 2009 TATA INDICAB DLE AP09TVA0485 Chasis No : 600137AQZP07327 Tax : Not Available Fuel Type Insurance : Diesel : 31/03/2015 FC : Not Available RC : RTO Forms RTA : Khairtabad Permit : Not Surrendered C/W : M/T Notes : form 26,28,29,30,35 will be given with in 25-30 days after sale amount received,any rta related work will be done by customer only,rto location not available 29 2009 TATA INDICAB DLE AP37TV1499 Chasis No : MAT6001379PE40943 Tax : Life Time Fuel Type Insurance : Diesel : 26/05/2015 FC : Not Available RC : Original RTA : Khairtabad Permit : Not Surrendered C/W : M/T Notes : Form 28,29,30& 35 will be issued on 10-15 working days after sale amount collected only 30 2008 TATA INDICAB DLE AP09TV8579 Chasis No : 600137CRZP47737 Tax : Not Applicable Fuel Type Insurance : Diesel : 17/07/2015 FC : Not Available RC : RTO Forms RTA : Khairtabad Permit : Not Surrendered C/W : M/T Notes : Form 26, 28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 31 2007 TATA INDICAB DLE AP09TV5706 Chasis No : 600137ESZP83929 Tax Paid Upto : 31/12/2013 Fuel Type Insurance : Diesel : 02/09/2015 FC : Not Available RC : RTO Forms RTA : Khairtabad Permit : Not Surrendered C/W : M/T Notes : Form 28,29,30 & 35 will be issued on 15-20 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 32 2007 TATA INDICAB DLE AP11TV1881 Chasis No : 600137MSZPH2919 Tax Paid Upto : 30/09/2013 Fuel Type Insurance : Diesel : 17/01/2015 FC : Not Available RC : RTO Forms RTA : Malakpet Permit : Not Surrendered C/W : M/T Notes : Form 28,29,30 & 35 will be issued on 15-20 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer * Please inspect equipment before buying * 15 / 35 Lot Num Shriram Automall India Ltd. 33 2007 TATA INDICAB DLE AP09TV5523 Chasis No : 600137DSZP70932 Tax Paid Upto : 31/12/2012 Fuel Type Insurance : Diesel : 22/01/2015 FC : Not Available RC : RTO Forms RTA : Khairtabad Permit : Not Surrendered C/W : M/T Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 34 2007 TATA INDICAB DLE AP09TV6286 Chasis No : 600137GSZPA3644 Tax Paid Upto : 30/09/2014 Fuel Type Insurance : Diesel : 21/11/2015 FC : Not Available RC : RTO Forms RTA : Khairtabad Permit : Not Surrendered C/W : M/T Notes : Form 28,29,30 & 35 will be issued on 15-20 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 35 2007 TATA INDICAB DLE AP13TV0398 Chasis No : 600137ASZP14860 Tax Paid Upto : 30/09/2014 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Mehdipatnam Permit : Not Surrendered C/W : M/T Notes : Form 28,29,30 & 35 will be issued on 15-20 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 36 2007 TATA INDICAB DLE AP09TV4176 Chasis No : 600137ASZP01747 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : 18/07/2015 FC : Not Available RC : RTO Forms RTA : Khairtabad Permit : Not Surrendered C/W : M/T Notes : Form 28,29,30 & 35 will be issued on 15-20 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 37 2006 TATA INDICAB DLE AP09TV3161 Chasis No : 600137KTZPF3196 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Khairtabad Permit : Not Surrendered C/W : M/T Notes : form 26,28,29,30,35 will be given with in 25-30 days after sale amount received,any rta related work will be done by customer only,rto location not available * Insurance and removal is buyer`s responsibility * 16 / 35 Lot Num Shriram Automall India Ltd. 38 2006 TATA INDICAB DLE AP29TV0130 Chasis No : 600137HTZPC4930 Tax Paid Upto : 31/03/2014 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 39 2010 TATA INDIGO MARINA LS AP09TVA1709 Chasis No : MAT601462AWG34643 Tax : Not Applicable Fuel Type Insurance : Diesel : 09/04/2015 FC : Not Available RC : RTO Forms RTA : Khairtabad Permit : Not Surrendered C/W : M/T Notes : form 26,28,29,30,35 will be given with in 25-30 days after sale amount received,any rta related work will be done by customer only,rto location not available 40 2008 TATA INDIGO LS AP10TV1384 Chasis No : 606321CRZP40458 Tax : Not Available Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Secunderabad Permit : Not Surrendered C/W : M/T Notes : form 26,28,29,30,35 will be given with in 25-30 days after sale amount received,any rta related work will be done by customer only,rto location not available 41 2009 HYUNDAI VERNA 1.5 CRDI VGT AP23S5556 Chasis No : MALCN41VR9M073697H Tax : Life Time Fuel Type Insurance : Petrol : Not Available RTA Permit C/W Notes : : : : FC : Not Available RC : Original Sangareddy Not Applicable M/T Not Applicable 42 2011 MAHINDRA VERITO 1.5 D2 AP28TV2549 Chasis No : MA1LSRGKFBZH20215 Tax : Life Time Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Applicable C/W : M/T Notes : 100% singlepaymenttosellerVehiclerelaseeafter100% saleamtRefundamountisoverandaboveRs.19999refundedwayofC hqRTGSDDwithin7workingdaysDocumentsgiven2540workingdaysaftersaleamountF362930only * Every item sold on "AS IS WHERE IS" basis * 17 / 35 Lot Num Shriram Automall India Ltd. 43 2008 TOYOTA INNOVA 2.5 G AP13X6461 Chasis No : MBJ11JV40071172130108 Tax Paid Upto : 30/09/2012 Fuel Type Insurance : Diesel : 23/01/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : RTA:MEDCHAL Form26, 28,29,30 & 35 will be issued on 25-30 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 44 2007 TOYOTA INNOVA 2.5 G AP10V8864 Chasis No : MBJ11JV40071058851007 Tax Paid Upto : 30/09/2013 Fuel Type Insurance : Diesel : 17/11/2015 FC : Not Available RC : RTO Forms RTA : Secunderabad Permit : Not Surrendered C/W : M/T Notes : Form 28,29,30 & 35 will be issued on 15-20 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 45 2007 TOYOTA INNOVA 2.5 G AP31TT6333 Chasis No : MBJ11JV4007074386 Tax Paid Upto : 31/12/2013 Fuel Type Insurance : Diesel : 05/07/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : Form 26, 28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 46 2004 TOYOTA QUALLS 2.4D FS AP26Y2122 Chasis No : LF501130090 Tax Paid Upto : 30/09/2013 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Bahadurpura Permit : Not Surrendered C/W : M/T Notes : Form 28,29,30 & 35 will be issued on 25-30 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 47 2004 TOYOTA QUALLS 2.4D FS AP13Y1247 Chasis No : LF501135397 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : 22/07/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : form 26,28,29,30,35 will be given with in 25-30 days after sale amount received,any rta related work will be done by customer only,rto location not available * SAMIL make no guarantees or warranties expressed or implied * 18 / 35 Lot Num Shriram Automall India Ltd. 48 2004 TOYOTA QUALLS 2.4D FS AP09X7243 Chasis No : LF501120469 Tax Paid Upto : 31/12/2013 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Applicable C/W : M/T Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 49 2002 TOYOTA QUALIS 2.4D FS AP16TT5456 Chasis No : LF5010583990602 Tax Paid Upto : 31/12/2013 Fuel Type Insurance : Diesel : 08/01/2016 FC : Not Available RC : Original RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : RTA:MEDCHAL Form 28,29,30& 35 will be issued on 10-15 working days after sale amount collected only 50 2007 CHEVROLET TAVERA NEO3 LS 7(C)STR AP16TW8125 Chasis No : MA6ABG767HA49794 Tax Paid Upto : 30/09/2014 Fuel Type Insurance : Diesel : 19/05/2015 FC : Not Available RC : RTO Forms RTA : Karimnagar Permit : Not Surrendered C/W : M/T Notes : form 26,28,29,30,35 will be given with in 25-30 days after sale amount received,any rta related work will be done by customer only,rto location not available 51 2006 MAHINDRA SCORPIO LX AP05TV0077 Chasis No : MA1TA2BSC62A64323 Tax : Not Available Fuel Type Insurance : Diesel : 14/05/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : FORM 26,35 WILL BE GIVEN WITH IN 25-35 DAYS AFTER SALE AMOUNT COLLECTED,any rta related work will be done by customer only 52 2007 TATA SUMO SPACIO GOLD STD AP28TA0107 Chasis No : 421056GSZ931547 Tax Paid Upto : 31/12/2013 Fuel Type Insurance : Diesel : 08/10/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer * Please inspect equipment before buying * 19 / 35 Lot Num Shriram Automall India Ltd. 53 2008 FORCE TRAX TOOFAN AP29U9863 Chasis No : T57057214B08 Tax Paid Upto : 30/06/2014 Fuel Type Insurance : Diesel : 26/11/2015 FC : Not Available RC : Original RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : Form 28,29,30&35 will be issued on 10-15 working days after sale amount collected only 54 2006 FORCE TRAX TOOFAN AP29U1005 Chasis No : T57040905D06 Tax Paid Upto : 31/03/2014 Fuel Type Insurance : Diesel : 06/06/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : RTA :IBRAHIMPATNAM Form 26,28,29,30 & 35 will be issued on 25-30 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 55 2003 FORCE TRAX TOOFAN AP28V5265 Chasis No : T57016826K03 Tax Paid Upto : 30/06/2014 Fuel Type Insurance : Diesel : 30/06/2015 FC : Not Available RC : Original RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : Form 28,29,30&35 will be issued on 10-15 working days after sale amount collected only 56 2011 TATA WINGER DLX AP28TC8970 Chasis No : MAT460062BUP08099 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : 28/02/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : FORM 26,35 WILL BE GIVEN WITH IN 25-35 DAYS AFTER SALE AMOUNT COLLECTED,any rta related work will be done by customer only 57 2011 TATA WINGER STD AP28TC5223 Chasis No : MAT460072BUA00020 Tax Paid Upto : 31/03/2013 Fuel Type Insurance : Diesel : 21/06/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : Form26, 28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer * Insurance and removal is buyer`s responsibility * 20 / 35 Lot Num Shriram Automall India Ltd. 58 2010 TATA WINGER STD AP26TT7434 Chasis No : MAT460000AUA00592 Tax Paid Upto : 30/09/2014 Fuel Type Insurance : Diesel : 27/07/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : FORM 26,35 WILL BE GIVEN WITH IN 25-35 DAYS AFTER SALE AMOUNT COLLECTED,any rta related work will be done by customer only 59 2010 TATA WINGER STD AP29TA8183 Chasis No : MAT460001AUA00438 Tax Paid Upto : 31/03/2014 Fuel Type Insurance : Diesel : 29/06/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 60 2009 TATA WINGER STD AP29V1833 Chasis No : 460001BQZU00526 Tax Paid Upto : 30/09/2013 Fuel Type Insurance : Diesel : 22/03/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 61 2008 TATA WINGER STD AP28TA2739 Chasis No : 460000LRZU04532 Tax Paid Upto : 30/09/2014 Fuel Type Insurance : Diesel : 25/07/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : Form 28,29,30 & 35 will be issued on 25-30 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 62 2008 TATA WINGER STD AP28Y5385 Chasis No : 460001CRZU00780 Tax Paid Upto : 31/03/2012 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Khairtabad Permit : Not Surrendered C/W : M/T Notes : Form 28,29,30 & 35 will be issued on 15-20 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer * Every item sold on "AS IS WHERE IS" basis * 21 / 35 Lot Num Shriram Automall India Ltd. 63 2008 TATA WINGER STD AP20X9259 Chasis No : 460051ARZU02293 Tax Paid Upto : 31/12/2012 Fuel Type Insurance : Diesel : 16/10/2015 FC : Not Available RC : RTO Forms RTA : Khammam Permit : Not Surrendered C/W : M/T Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 64 2011 TATA VENTURE GX AP23X4316 Chasis No : MAT483569BYG07147 Tax Paid Upto : 31/03/2014 Fuel Type Insurance : Diesel : 15/08/2015 FC : Not Available RC : RTO Forms RTA : Sangareddy Permit : Not Surrendered C/W : M/T Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 65 2011 TATA MAGIC 4X2 MINI BUS AP24TA2847 Chasis No : MAT445112BVA08259 Tax Paid Upto : 30/06/2014 Fuel Type Insurance : Diesel : 21/12/2015 FC : Not Available RC : RTO Forms RTA : Nalgonda Permit : Not Surrendered C/W : M/T Notes : Form 28,29,30 & 35 will be issued on 15-20 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 66 2011 TATA MAGIC 4X2 MINI BUS AP25X2449 Chasis No : MAT445112BVN98445 Tax Paid Upto : 31/03/2013 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Nizamabad Permit : Not Surrendered C/W : M/T Notes : Form 28,29,30 & 35 will be issued on 25-30 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 67 2011 TATA MAGIC 4X2 MINI BUS AP25TV1506 Chasis No : MAT445112BVA04287 Tax : Life Time Fuel Type Insurance : Diesel : 25/03/2015 FC : Not Available RC : RTO Forms RTA : Nizamabad Permit : Not Surrendered C/W : SPRING SUSP Notes : FORM 26,35 WILL BE GIVEN WITH IN 25-35 DAYS AFTER SALE AMOUNT COLLECTED,any rta related work will be done by customer only * SAMIL make no guarantees or warranties expressed or implied * 22 / 35 Lot Num Shriram Automall India Ltd. 68 2011 TATA MAGIC 4X2 MINI BUS AP21TT9573 Chasis No : MAT445112BVE45852 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : 26/06/2015 FC : Not Available RC : FRC RTA : Rangareddy Permit : Surrendered C/W : M/T Notes : RTA:R.R.EAST F-28,29 30 WILL BE GIVEN WITHIN 15-20 WORKING DAYS AFTER SALE AMOUNT COLLCETED ONLY 69 2011 TATA MAGIC 4X2 MINI BUS AP22Y3954 Chasis No : MAT445112BVD31257 Tax Paid Upto : 31/03/2013 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Mahaboobnagar Permit : Not Surrendered C/W : M/T Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 70 2010 TATA MAGIC 4X2 MINI BUS AP28TC1141 Chasis No : MAT445113AVH61296 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : 30/10/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : FORM 26,35 WILL BE GIVEN WITH IN 25-35 DAYS AFTER SALE AMOUNT COLLECTED,any rta related work will be done by customer only 71 2010 TATA MAGIC 4X2 MINI BUS AP23Y2464 Chasis No : MAT445113AVK72222 Tax Paid Upto : 30/06/2014 Fuel Type Insurance : Diesel : 24/12/2015 FC : Not Available RC : RTO Forms RTA : Sangareddy Permit : Not Surrendered C/W : M/T Notes : form 26,28,29,30,35 will be given with in 25-30 days after sale amount received,any rta related work will be done by customer only,rto location not available 72 2010 TATA MAGIC 4X2 MINI BUS AP22Y0586 Chasis No : MAT445111AVJ70287 Tax Paid Upto : 30/09/2014 Fuel Type Insurance : Diesel : 29/10/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : M/T Notes : Form26, 28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer * Please inspect equipment before buying * 23 / 35 Lot Num Shriram Automall India Ltd. 73 2010 TATA MAGIC 4X2 MINI BUS AP07TA3076 Chasis No : MAT445111AVE36891 Tax Paid Upto : 31/03/2014 Fuel Type Insurance : Diesel : 30/05/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : m/t Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 74 2010 TATA MAGIC 4X2 MINI BUS AP15TV1745 Chasis No : MAT445121AVE37485 Tax : Life Time Fuel Type Insurance : Diesel : 02/07/2016 FC : Not Available RC : FRC RTA : Karimnagar Permit : Surrendered C/W : M/T Notes : form 28,29,30 will issued with in 15-20 days after sale amount received 75 2009 TATA MAGIC 4X2 MINI BUS AP23TV0246 Chasis No : MAT4451219VH27194 Tax : Life Time Fuel Type Insurance : Diesel : 29/11/2015 FC : Not Available RC : Original RTA : Sangareddy Permit : Surrendered C/W : M/T Notes : Form 28,29,30&35 will be issued on 10-15 working days after sale amount collected only 76 2009 TATA MAGIC 4X2 MINI BUS AP36TV0358 Chasis No : 445121AQZV02179 Tax : Life Time Fuel Type Insurance : Diesel : 29/06/2015 FC : Not Available RC : FRC RTA : Sangareddy Permit : Surrendered C/W : Spring Suspension Notes : Form 28,29,30 will be issued on 10-15 working days after sale amount collected only 77 2009 TATA MAGIC 4X2 MINI BUS AP02TV0849 Chasis No : MAT4451219VH26808 Tax Paid Upto : 30/09/2013 Fuel Type Insurance : Diesel : 10/08/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : SPRING SUSP Notes : FORM 26,35 WILL BE GIVEN WITH IN 25-35 DAYS AFTER SALE AMOUNT COLLECTED,any rta related work will be done by customer only * Insurance and removal is buyer`s responsibility * 24 / 35 Lot Num Shriram Automall India Ltd. 78 2011 TATA ACE Pick Up AP36TA2175 Chasis No : MAT445222BZE46113 Tax Paid Upto : 31/03/2014 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Warangal Permit : Not Applicable C/W : Spring Suspension Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 79 2011 TATA ACE 4X2 PICKUP AP28TA7332 Chasis No : MAT445057BZB13670 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : 01/04/2015 FC : Not Available RC : Original RTA : Rangareddy Permit : Not Applicable C/W : Spring Suspension Notes : Form 28,29,30& 35 will be issued on 10-15 working days after sale amount collected only 80 2009 TATA ACE 4X2 PICKUP AP28TB5904 Chasis No : MAT4450569ZP54169 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Applicable C/W : Spring Suspension Notes : FORM 26,35 WILL BE GIVEN WITH IN 25-35 DAYS AFTER SALE AMOUNT COLLECTED,any rta related work will be done by customer only 81 2009 TATA ACE 4X2 PICKUP AP16TB0302 Chasis No : 445051AQZY00350 Tax Paid Upto : 30/06/2014 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Vijayawada Permit : Not Applicable C/W : spring susp Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 82 2009 TATA ACE 4X2 PICKUP AP27Y0681 Chasis No : MAT4450519ZD03619 Tax Paid Upto : 31/12/2013 Fuel Type Insurance : Petrol : 24/11/2015 FC : Not Available RC : RTO Forms RTA : Sangareddy Permit : Not Applicable C/W : SPRING SUSPENTION, BED L 7.1 X W 4.9 Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer * Every item sold on "AS IS WHERE IS" basis * 25 / 35 Lot Num Shriram Automall India Ltd. 83 2007 TATA ACE 4X2 PICKUP AP23W2615 Chasis No : 445010FSZR35512 Tax Paid Upto : 31/12/2013 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Sangareddy Permit : Not Applicable C/W : SPRING SUSP Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 84 2007 TATA ACE 4X2 PICKUP AP09Y9112 Chasis No : 445056GSZR45601 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : 13/08/2015 FC : Not Available RC : RTO Forms RTA : Khairtabad Permit : Not Applicable C/W : Spring Suspension Notes : form 26,28,29,30,35 will be given with in 25-30 days after sale amount received,any rta related work will be done by customer only,rto location not available 85 2006 TATA ACE BS II 4X2 PICKUP AP26X1632 Chasis No : 445010DTZR14586 Tax Paid Upto : 30/09/2014 Fuel Type Insurance : Diesel : 28/03/2015 FC : Not Available RC : Original RTA : Rangareddy Permit : Not Applicable C/W : spring susp Notes : Forms 28,29,30,35 will be issued on 25-30 days after payment collected 86 2012 MAHINDRA MAXXIMO 4X2 PICK UP AP23Y8495 Chasis No : MA1FA2MCRC6F12546 Tax Paid Upto : 30/09/2014 Fuel Type Insurance : Diesel : 19/07/2015 FC : Not Available RC : RTO Forms RTA : Siddipet Permit : Not Applicable C/W : SPRING SUSP Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 87 2010 MAHINDRA MAXXIMO 4X2 PICK UP AP09TA6305 Chasis No : MA1FA2MCRA6M35892 Tax Paid Upto : 30/09/2013 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Khairtabad Permit : Not Applicable C/W : Spring suspension Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer * SAMIL make no guarantees or warranties expressed or implied * 26 / 35 Lot Num Shriram Automall India Ltd. 88 2010 MAHINDRA MAXXIMO 4X2 PICK UP AP28TA5718 Chasis No : MA1FA2HRRA6H23726 Tax Paid Upto : 30/06/2014 Fuel Type Insurance : Diesel : 16/09/2015 FC : Not Available RC : Original RTA : Rangareddy Permit : Not Applicable C/W : Spring Suspension Notes : RTA:MEDCHAL Form 28,29,30& 35 will be issued on 10-15 working days after sale amount collected only 89 2012 MAHINDRA BOLEROCAMPER PICK UP AP23Y6867 Chasis No : MA1ZN2GHKC1F47667 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : 08/08/2015 FC : Not Available RC : RTO Forms RTA : Sangareddy Permit : Not Applicable C/W : Spring Suspension Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 90 2009 PIAGGIO APE CARGO D 600 AP23W9191 Chasis No : MBX0000FBLL955458 Tax Paid Upto : 30/09/2014 Fuel Type Insurance : Diesel : 18/12/2015 FC : Not Available RC : RTO Forms RTA : Sangareddy Permit : Not Applicable C/W : Spring suspension Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 91 2011 TATA LPT3118 TC 8X2 CARGO TRUCK AP28TC6579 Chasis No : MAT466383B3H22803 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : 22/09/2015 FC : Not Available RC : Original RTA : Rangareddy Permit : Surrendered C/W : Spring Suspension Notes : FORMS 28,29,30,35 will be issued on 25-30 days after payment collected. 92 2010 TATA LPT3118 TC 8X2 CARGO TRUCK AP16TY5234 Chasis No : MAT466401A2C07934 Tax Paid Upto : 31/03/2015 Fuel Type Insurance : Diesel : 20/04/2015 FC : Not Available RC : FRC RTA : Sangareddy Permit : Surrendered C/W : Spring Suspension Notes : Form 28,29,30 will be issued on 10-15 working days after sale amount collected only * Please inspect equipment before buying * 27 / 35 Lot Num Shriram Automall India Ltd. 93 2002 TATA LPT2515 6X2 CARGO TRUCK AP16TT6672 Chasis No : 426010FXZ112196 Tax Paid Upto : 31/12/2012 Fuel Type Insurance : Diesel : 08/08/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : Spring Suspension Notes : RTA:MEDCHAL FORMS 26,28,29,30,35 will be issued on 25-30 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 94 1998 TATA LP608 4X2 CARGO TRUCK AP28U0998 Chasis No : 373043KRQ120164 Tax Paid Upto : 30/06/2014 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : Spring Suspension Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 95 1996 TATA SE1612 4X2 CARGO TRUCK AP09U8080 Chasis No : 365073BTQ105194 Tax Paid Upto : 30/09/2014 Fuel Type Insurance : Diesel : 28/12/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : Spring Suspension Notes : form 26,28,29,30,35 will be given with in 25-30 days after sale amount received,any rta related work will be done by customer only,rto location not available 96 2008 ASHOKLEYLAND 2214/1S 6X2 CARGO TRUCK AP28TA1899 Chasis No : PNE642508 Tax Paid Upto : 30/09/2013 Fuel Type Insurance : Diesel : 17/01/2016 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : Spring Suspension Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 97 2008 ASHOKLEYLAND 2214 6X2 CARGO TRUCK AP28Y7876 Chasis No : FNA096894 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : 12/11/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : Spring Suspension Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer * Insurance and removal is buyer`s responsibility * 28 / 35 Lot Num Shriram Automall India Ltd. 98 2006 ASHOKLEYLAND TUSKER SUPER 2214 6X2 CARGO TRUCK AP28X1116 Chasis No : TFR235945 Tax Paid Upto : 31/12/2012 Fuel Type Insurance : Diesel : 08/02/2015 FC : Not Available RC : RTO Forms RTA : Sangareddy Permit : Not Surrendered C/W : SPRING SUSP Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 99 2005 ASHOKLEYLAND 2214/1S 6X2 CARGO TRUCK AP16TV0442 Chasis No : WDE545692 Tax Paid Upto : 31/03/2015 Fuel Type Insurance : Diesel : 15/04/2015 FC : Not Available RC : FRC RTA : Sangareddy Permit : Surrendered C/W : Spring Suspension Notes : Form 28,29,30 will be issued on 10-15 working days after sale amount collected only 100 1999 ASHOKLEYLAND 1611 COMET 4X2 CARGO TRUCK AP01W4273 Chasis No : QKE421276 Tax Paid Upto : 30/09/2013 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Adilabad Permit : Not Surrendered C/W : Spring Suspension Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 101 2008 ASHOKLEYLAND 2516/2 6X4 TIPPER AP28Y3622 Chasis No : PNH128581 Tax Paid Upto : 30/06/2014 Fuel Type Insurance : Diesel : 07/05/2015 FC : Not Available RC : Original RTA : Rangareddy Permit : Not Surrendered C/W : Not Available Notes : Form 28,29,30&35 will be issued on 10-15 working days after sale amount collected only 102 2008 ASHOKLEYLAND 2516/2 6X4 TIPPER AP28Y7713 Chasis No : FNE658900 Tax Paid Upto : 31/03/2014 Fuel Type Insurance : Diesel : 18/04/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : Not Available Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer * Every item sold on "AS IS WHERE IS" basis * 29 / 35 Lot Num Shriram Automall India Ltd. 103 2007 ASHOKLEYLAND 2516/2 6X4 TIPPER AP28TA2319 Chasis No : TPE637191 Tax Paid Upto : 30/06/2013 Fuel Type Insurance : Diesel : 30/03/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : Not Available Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 104 2007 ASHOKLEYLAND 2516/2 6X4 TIPPER AP28X7495 Chasis No : ZPE619990 Tax Paid Upto : 30/06/2013 Fuel Type Insurance : Diesel : 30/03/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : Not Available Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 105 2005 ASHOKLEYLAND 2516/2 6X4 TIPPER AP21X1855 Chasis No : MDE563197 Tax Paid Upto : 30/06/2014 Fuel Type Insurance : Diesel : 30/03/2015 FC : Not Available RC : Original RTA : Bahadurpura Permit : Not Surrendered C/W : Not Available Notes : Form 28,29,30&35 will be issued on 10-15 working days after sale amount collected only 106 2003 EICHER 11.10 4X2 CARGO TRUCK AP10W0610 Chasis No : 20GC31203265 Tax Paid Upto : 30/06/2014 Fuel Type Insurance : Diesel : 18/07/2015 FC : Not Available RC : RTO Forms RTA : Sangareddy Permit : Not Surrendered C/W : Spring Suspension Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 107 2005 EICHER 10.95 4X2 CARGO TRUCK AP10W7025 Chasis No : 29HC5B118107 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : 23/05/2015 FC : Not Available RC : Original RTA : Secunderabad Permit : Not Surrendered C/W : SPRING SUSP Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer * SAMIL make no guarantees or warranties expressed or implied * 30 / 35 Lot Num Shriram Automall India Ltd. 108 2003 EICHER 10.90 4X2 CARGO TRUCK AP10W1436 Chasis No : 17FC30592842 Tax Paid Upto : 31/03/2015 Fuel Type Insurance : Diesel : 05/06/2015 FC : Not Available RC : FRC RTA : Sangareddy Permit : Surrendered C/W : Spring Suspension Notes : Form 28,29,30 will be issued on 10-15 working days after sale amount collected only 109 1997 EICHER 10.75 4X2 CARGO TRUCK AP09U9994 Chasis No : 16EC70244611 Tax : Not Available Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : Spring Suspension Notes : RTA MEDCHAL FORMS 26,28,29,30,35 will be issued on 25-30 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 110 2008 TATA LPT1109 EX AP28TB0391 Chasis No : 416441GRZ728697 Tax : Not Available Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : SPRING SUSP Notes : Not Applicable 111 2005 TATA LPT909 4X2 FLAT BED TRUCK AP29T6056 Chasis No : 382321BUZ707947 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : 26/05/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : Spring Suspension Notes : FORM 26,35 WILL BE GIVEN WITH IN 25-35 working DAYS AFTER SALE AMOUNT COLLECTED.any rta related work will done by customer only 112 2012 TATA LPT407 4X2 CARGO TRUCK AP23Y5954 Chasis No : MAT455212C8B09077 Tax Paid Upto : 30/09/2014 Fuel Type Insurance : Diesel : 25/03/2015 FC : Not Available RC : RTO Forms RTA : Sangareddy Permit : Not Surrendered C/W : SPRING SUSP Notes : Form 28,29,30 & 35 will be issued on 25-30 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer * Please inspect equipment before buying * 31 / 35 Lot Num Shriram Automall India Ltd. 113 2005 SWARAJMAZDA SAMRAT ZT 54 4X2 CARGO TRUCK AP28W4800 Chasis No : MGZGL4GM0098642 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : 17/06/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : SPRING SUSP Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 114 2004 SWARAJMAZDA SAMRAT ZT 54 4X2 CARGO TRUCK AP27V2755 Chasis No : WHZGL4FM0076826 Tax Paid Upto : 30/06/2014 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : SPRING SUSP Notes : RTA:MEDCHAL FORMS 26,28,29,30,35 will be issued on 25-30 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 115 2004 SWARAJMAZDA SAMRAT ZT 54 4X2 CARGO TRUCK AP11W7742 Chasis No : UHZGL4GM0078475 Tax Paid Upto : 31/12/2014 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Malakpet Permit : Not Surrendered C/W : SPRING SUSP Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer 116 2003 SWARAJMAZDA SAMRAT ZT 54 4X2 CARGO TRUCK AP10W3311 Chasis No : RIZGL4GM0071121 Tax Paid Upto : 31/12/2013 Fuel Type Insurance : Diesel : 14/02/2015 FC : Not Available RC : RTO Forms RTA : Hyderabad Permit : Not Surrendered C/W : Spring suspension Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 117 1996 SWARAJMAZDA SAMRAT ZT 54 4X2 CARGO TRUCK AP16W0850 Chasis No : E96ZGL4GM0036104 Tax Paid Upto : 30/09/2014 Fuel Type Insurance : Diesel : 30/03/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : Spring Suspension Notes : FORM 26,35 WILL BE GIVEN WITH IN 25-35 DAYS AFTER SALE AMOUNT COLLECTED,any rta related work will be done by customer only * Insurance and removal is buyer`s responsibility * 32 / 35 Lot Num Shriram Automall India Ltd. 118 1995 SWARAJMAZDA SUPER 4X2 CARGO TRUCK AP15T4434 Chasis No : B95ZGL4GM0032486 Tax Paid Upto : 30/09/2014 Fuel Type Insurance : Diesel : Not Available FC : Not Available RC : RTO Forms RTA : Karimnagar Permit : Not Surrendered C/W : Spring suspension Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 119 1995 SWARAJMAZDA WT 48 4X2 CARGO TRUCK AP12V1159 Chasis No : D95WEL4GM0031153 Tax Paid Upto : 30/06/2014 Fuel Type Insurance : Diesel : 14/06/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Surrendered C/W : SPRING SUSP Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 120 2005 JCBINDIALTD JCB 3D LOADER BACKHOE AP24F6511 Chasis No : 1038200 Tax : Life Time Fuel Type Insurance : Diesel : 16/03/2015 FC : Not Available RC : RTO Forms RTA : Nalgonda Permit : Not Applicable C/W : Not Available Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 121 2009 SWARAJTRACTORS SWARAJ843XM AgricultureTrac AP15TA2523 Chasis No : QUTD23705010859 Tax Paid Upto : 30/06/2013 Fuel Type Insurance : Diesel : 19/10/2015 FC : Not Available RC : Original RTA : Sangareddy Permit : Not Surrendered C/W : Not Available Notes : Form 28,29,30&35 will be issued on 10-15 working days after sale amount collected only 122 2007 MAHINDRA 575DI BHOOMIPUTRA AGRICULTURE TRACTOR AP23L7270 Chasis No : NARW9298 Tax Paid Upto : 31/03/2015 Fuel Type Insurance : Diesel : 16/01/2016 FC : Not Available RC : Original RTA : Sangareddy Permit : Not Applicable C/W : Not Available Notes : Form 28,29,30&35 will be issued on 10-15 working days after sale amount collected only * Every item sold on "AS IS WHERE IS" basis * 33 / 35 Lot Num Shriram Automall India Ltd. 123 2008 MAHINDRA 275DI AGRICULTURE TRACTOR AP16TY1651 Chasis No : RDT22956 Tax Paid Upto : 31/03/2011 Fuel Type Insurance : Diesel : 07/11/2015 FC : Not Available RC : RTO Forms RTA : Rangareddy Permit : Not Applicable C/W : Not Available Notes : FORMS 26,28,29,30,35 will be issued on 2530 days after payment collected.If any RTA releated issues and pending TAX should be bear by the buyer 124 2005 MAHINDRA 275DI AGRICULTURE TRACTOR AP23H9790 Chasis No : NRTW1307 Tax Paid Upto : 31/03/2013 Fuel Type Insurance : Diesel : 13/03/2015 FC : Not Available RC : RTO Forms RTA : Sangareddy Permit : Not Surrendered C/W : Not Available Notes : Form 26,28,29,30 & 35 will be issued on 2530 working days after sale amount collected.If any RTA releated issues and pending TAX should be bear by the buyer * Thank You For Attending Event At Shriram Automall. * Next SAMIL Event At KHAMMAM YARD On February 09, 2015 * SAMIL make no guarantees or warranties expressed or implied * 34 / 35 Lot Num Shriram Automall India Ltd. NOTES:- * Please inspect equipment before buying * Shriram Automall India Ltd. This document contains confidential proprietary information and is intended solely for the use of Shriram Automall India Ltd. Any Unauthorized use is strictly prohibited This Catalogue was created on 2/6/2015 please check for most accurate and uptodate information with our office
© Copyright 2024