18 - Revista Nueva Minería y Energía

Avisos.indd 1
29-02-16 16:57
Avisos.indd 1
10-03-16 14:08
Avisos.indd 1
10-03-16 14:08
Avisos.indd 1
07-03-16 14:48
Avisos.indd 1
07-03-16 14:49
Avisos.indd 1
07-03-16 14:50
Año 7 / Número 85 / Marzo 2016
n m e / M a r zo 2 0 1 6
Editorial
5
Reportaje
6
Proveedores mineros:
Afectados por la coyuntura
Minería
10
Minería
18
Entrevista
30
Productividad, la respuesta de la
minería en tiempos difíciles
Proveedores mineros buscan
ponerse al día con la sustentabilidad
Joseph Ramos, presidente de la
Comisión Nacional de Productividad:
“Tenemos una oportunidad
para hacer las cosas mejor”
Visión Global
36
Visión Global
40
Energía
46
Energía
52
Medio Ambiente
64
Minería en México:
Testigo del vaivén de las inversiones
Chile y Australia:
Consolidando sus lazos comerciales
ERNC, pisando fuerte
Abengoa, enfrentando la emergencia
Gestión de relaves: el desafío
GSRWXERXIHIPEWIKYVMHEH]PEI½GMIRGME
Medio Ambiente
Hacia la reducción del consumo
del recurso hídrico
68
Innovación
76
Universidades
84
3HUÀO
Especial Técnico
88
Industria
96
Innovación, I+D y transferencia
tecnológica: Las claves para el
desarrollo sustentable
Ingeniería de Minas U. de Talca:
Minería en zona agropecuaria
Proveedores:
Afectados por
la coyuntura
Joseph Ramos:
“Tenemos una
oportunidad
para hacer las
cosas mejor”
6
30
Productividad,
el foco de la minería
10
ERNC,
pisando fuerte
46
Juan Medel: toda una vida en Codelco
Bombas en la minería:
Foco en el gigantismo
Cifras
106
En imágenes
108
Agenda
111
Gestión de relaves,
constante desafío
64
Innovación:
Clave para el
desarrollo
sustentable
76
marzo 3 nme
CONTENIDO 3.indd 3
08-03-16 16:17
Área de
Conferencias
& Eventos
Programa 2016
Seminario - ERNC
en Chile:
Seminario Interconexión SIC-SING:
II Versión
Congreso:
Experiencia y desempeño
a 8 años de la Ley 20.257
Oportunidades y desafíos de la
integración
“Energía, Nuestros
Grandes Desafíos”
18 abril de 2016
20 junio de 2016
26 septiembre de 2016
Revista Nueva Minería y Energía junto a la empresa CTG Energía, organizarán,
tres encuentros especializados durante el 2016 para avanzar en el desarrollo
de las respuestas y soluciones que el país necesita.
Patrocinadores
CIFES
seminarios@nuevamineria.com | contacto@nuevamineria.com | Teléfono: 56-2-23377200
SEMINARIO NME.indd 1
07-03-16 14:50
Industria proveedora de la minería:
En un momento clave
El alicaído escenario minero seguirá dejando huellas en
el sector, especialmente entre los proveedores. Así las
cosas, hoy parece más necesario que nunca generar nuevas
oportunidades para potenciar las áreas de automatización,
control y todo aquello que apunte a un ahorro de costos, una
mayor eficiencia y una mejor productividad en el sector.
Marzo 2016 año 7 edición 85
Director:
Guillermo Cifuentes J.
Socios directores:
Lucía Arratia V.
Andrés del Pedregal V.
Editor general:
Joaquín Ruiz C.
Periodistas:
Daniela Tapia S.
Camila Morales M.
N
o son tiempos fáciles para la minería. Ni para las grandes compañías productoras, ni para
las pequeñas empresas proveedoras, que en el último tiempo se han convertido en un actor
estratégico en la cadena de valor de la industria minera, jugando un rol fundamental para el
Colaboradores:
Paula Chapple C. (Santiago)
Rodrigo López A. (Santiago)
Nicolás Rojas B. (Antofagasta)
Eric Rivera C. (Valparaíso)
Paulina Pérez G. (Europa)
óptimo funcionamiento de las operaciones del sector.
Publicidad:
Catherine Manríquez V.
Matilde Oyarzún O.
Verónica Pla B.
Claudia Poduje D.
Paula Flores B.
Y las consecuencias están a la vista. Despidos, recortes de presupuesto, ajustes en los stocks
(MWIyEHSVKVj½GS
Alex López H.
huellas. Es por esto que la industria proveedora ha enarbolado su rol clave que tiene en el
Diseño:
Carola Esquivel R.
El difícil momento por el que atraviesa el rubro minero debido a la baja del precio del cobre
ha golpeado fuerte a los proveedores, un sector compuesto en un 66% por micro y pequeñas
empresas que han sentido especialmente la inestabilidad que hoy vive el negocio minero.
locales y en equipamientos tecnológicos e incluso renegociación de contratos son parte del
abanico de situaciones que los proveedores han debido enfrentar durante gran parte de 2015.
Lo preocupante es que este año no será distinto. El alicaído escenario minero seguirá dejando
desarrollo de la minería, y ha dicho que la única solución para salir de este oscuro callejón es
MQTPIQIRXEVQERIVEWMRRSZEHSVEWHILEGIVPEWGSWEWGSRIP½RHIQINSVEVPETVSHYGXMZMHEH
Ilustración portada:
Ana Flores M.
9RVIXSIRIPUYIEHIQjWWIZYIPZITVMSVMXEVMSEPGER^EVYREQE]SVGSR½ER^E]YRXVEFENSQjW
Fotografía:
Felipe Pinto V.
Iván Rodríguez R.
en esta materia. Sólo basta recordar la medida tomada en diciembre pasado por BHP Billiton,
Distribución:
B&G
Impresión:
Quad / Graphics Chile S.A.
Certificado PEFC
Este papel proviene
de bosques manejados
de forma sustentable
y fuentes controladas.
PEFC/24-31-900
www.pefc.org
coordinado entre proveedores y empresas mandantes, considerando que no fue un año fácil
que decidió postergar el pago a sus proveedores de 30 a 60 días, argumentando el “actual
escenario que vive la minería”.
Una mala señal, pero que plantea el desafío ineludible para ambos actores de continuar con
XSHSWPSWIWJYIV^SW]KIWXMSRIWTEVELEGIVI½GMIRXIWPSWTVSGIWSW]TVSXIKIVPSWQjVKIRIW
de rentabilidad.
Así las cosas, este es un tiempo en el que varios expertos han puesto énfasis en la necesidad
de generar nuevas oportunidades para potenciar las áreas de automatización, control y todo
EUYIPPSUYIETYRXIEYRELSVVSHIGSWXSWYREQE]SVI½GMIRGME]YREQINSVTVSHYGXMZMHEH
Revista Nueva Minería & Energía
es una publicación mensual de
)HMGMSRIW1EMTS7%GSRS½GMREW
KIRIVEPIWIR'SVSRIPS½GMRE
Providencia, Santiago de Chile.
Teléfono (56-2) 2 337 7200
E-mail: contacto@nuevamineria.com
Además, hay voces que han dicho que se pueden explorar incentivos del Estado para aquellas
mineras que logren alianzas de largo plazo con proveedores, dirigidas a crear servicios y bieRIWHIGPEWIQYRHMEPTEVEWIVI\TSVXEHSW)R½RZEVMEW±VIGIXEW²UYIFYWGERUYIPEMRHYWXVME
TVSZIIHSVEWIQERXIRKEE¾SXIIRQIHMSHIPGSQTPINSIWGIREVMSUYILS]ZMZIPEQMRIVuE
marzo 5 nme
EDITORIAL 5.indd 5
08-03-16 17:33
Ilustración: Daniel Cáceres
Proveedores mineros:
Afectados por la coyuntura
Son una pieza clave del gran rompecabezas de la industria. Los
proveedores mineros han adquirido un rol fundamental para
el óptimo funcionamiento de las operaciones. Es por ello que
también han debido idear estrategias para mantenerse a flote en
medio del complejo escenario que hoy vive la minería.
Camila Morales
nme 6 ma
m
marzo
arzo
z
zo
REP PROOVE 6-9.indd 6
07-03-16 17:43
Foto: Codelco
De acuerdo a datos de Fundación
Chile, sólo el 34% de los proveedores
exportó productos y/o servicios durante
2012, y para la mayoría de las empresas
las exportaciones representaron menos
del 10% de sus ventas totales.
C
omo un efecto dominó, la baja que
ha experimentado el precio del cobre y
de otros minerales ha traído consecuencias para todos los actores que forman
parte del negocio minero. Ciertamente
ha inquietado a las compañías productoras, pero ha remecido especialmente
a las empresas proveedoras, que han
visto tambalear contratos y servicios en
este nuevo escenario más estrecho y
con menos margen para negociar.
Es que a la caída de los precios se suman otros factores que ya se conocían,
como la baja en las leyes de mineral, el
alto costo de la energía, la escasez hídrica en el norte y los retos asociados
a mejorar el rendimiento laboral. Todos
aspectos que presionan a la industria a
capear el temporal de la mano de una
mayor austeridad y planes de contención de costos que han impactado a
proveedores y empresas de servicios.
El escenario preocupa particularmente
a este grupo de empresas, un sector
que ha registrado un importante crecimiento en los últimos años. En efecto, si
ya en la década de los 2000 la industria
constató un relevante aumento en la
demanda por productos y/o servicios,
una década más tarde los proveedores
mineros se consolidaban como un sector clave del negocio con 4.643 empresas prestadoras de servicios. En 2012
ese número ya había subido a 5.998
sociedades inscritas, con un alza de 29%,
de acuerdo a datos de Fundación Chile.
)WXIWMKRM½GEXMZSEYQIRXSZMRSEWMQTPM½GEV
las funciones en diversas áreas de las opeVEGMSRIW]EHMZIVWM½GEVPESJIVXEHIWIVZMcios. Así, un 34% de las empresas proveeHSVEWWIGPEWM½GERIRIPVYFVS±7IVZMGMSWHI
7STSVXI²QMIRXVEWUYIYRWIEKVYTER
IR±)UYMTSW² YRIR±'SRXVEXMWXEW² ]
YRIR±7IVZMGMSWHI-RKIRMIVuE]'SRWYPXSVuE²WIKRYRGEXEWXVSHI
7MR IQFEVKS PE MRIWXEFMPMHEH IR IP RIgocio ha tenido repercusiones para las
empresas proveedoras mineras, especialmente para las más pequeñas, que
representan un 66% del total.
Consecuencias en el empleo, en los
stocks locales y en equipamientos tecnológicos, son parte del abanico de situaciones que los proveedores han debido enfrentar.
Radiografía del negocio
De acuerdo a datos de Cochilco, sólo en
2012 la Gran Minería realizó compras
HI FMIRIW ] WIVZMGMSW TSV 97 millones -sin considerar energía y combustibles-, cifra que representa a nivel
GSQTEVEXMZSIPHIP4-&GLMPIRS(I
este monto, un 93% de las compras fueron realizadas a empresas proveedoras
constituidas en el país.
)WXIHEXSVI¾INEPEMQTSVXERXIZMRGYPEción de las grandes empresas mineras
con el rubro de proveedores nacionales,
relación que no ha quedado exenta de
desafíos en medio del actual escenario
que condiciona al rubro.
±'SR TVIGMSW HIP GSFVI IR RMZIPIW EGtuales y como se proyectan para los dos
años venideros, sin lugar a dudas este
período será uno de los más complejos
UYI RSW LE XSGEHS IRJVIRXEV 4SV IWS
una de las tareas más relevantes que
tenemos pendiente es convencer a la
industria que a través nuestro se pueden acelerar e implementar maneras
innovadoras de hacer las cosas que se
pueden traducir en mejoras de proHYGXMZMHEH²I\TPMGE4EWGYEP:IMKETVIWMHIRXIHIPE%WSGMEGMzRHI4VSZIIHSVIW
-RHYWXVMEPIWHIPE1MRIVuE%TVMQMR
Esta visión es compartida por Denny
7EPEW HMVIGXSV8IWSVIVSHIPE%WSGMEGMzR
+VIQMEP HI 7YQMRMWXVEHSVIW8qGRMGEW ]
HI-RKIRMIVuETEVEPE1MRIVuEI-RHYWXVME
7YXQMR UYMIR WIyEPE UYI TSXIRGMEV PE
GSR½ER^EIRXVIIQTVIWEWQMRIVEW]TVSveedoras es un reto fundamental debido
a la coyuntura que vive la industria.
±)WMQTSVXERXIXVEFENEVPEWGSR½ER^EWIRtre mandantes y proveedores para que
estos últimos puedan aportar a una minería moderna y tecnológicamente acorde
a la situación actual. Asimismo, potenciar
las asociaciones entre proveedores para
compartir experiencias y ser una contraparte real frente a las grandes empresas
QMRIVEWUYI½NERYRMPEXIVEPQIRXIIWEWVIPEGMSRIW IWSXVSTYRXSEXVEFENEV² E½VQE
IPVITVIWIRXERXIHI7YXQMR
0SKVEV YRE QE]SV GIVGERuE ] GSR½ER^E
entre proveedores y empresas mandantes es un desafío cada vez más presente
marzo 7 nme
REP PROOVE 6-9.indd 7
07-03-16 17:44
Foto: Aprimin
“Estamos convencidos que la minería
y la industria proveedora que se ha
desarrollado alrededor de ella es de lo
mejor que tenemos en nuestro país”.
Foto: Sutmin
Pascual Veiga, presidente de Aprimin.
“Es importante trabajar las confianzas
entre mandante y proveedores para que
estos últimos puedan aportar
a una minería moderna”.
Foto: Felipe Pinto
Denny Salas, director Tesorero de Sutmin.
en la industria, sobre todo por los hechos
que marcaron la relación entre estos dos
actores durante 2015. Sólo basta recordar la decisión que tomó en diciembre
pasado la empresa BHP Billiton en el
sentido de postergar el pago a sus proveedores de 30 a 60 días, argumentando
el “actual escenario que vive la minería”.
En la opinión de los proveedores, esta
es una mala señal para las empresas
HIPWIGXSV]EUYIPEW½VQEWHIFMIRIW]
servicios tendrán que soportar tasas de
½RERGMEQMIRXS WYTIVMSVIW TSV PS UYI
aumentaría el riesgo de cierre o incluso
de quiebra.
Esta visión es compartida por el académico Gustavo Lagos, quien proyecta un año
débil para las compañías proveedoras.
“El desarrollo de las empresas proveedoras para este 2016 lo proyecto pobre
por falta de demanda, debido al bajo
precio del cobre y de otros commodities minerales. Es posible que las exportaciones bajen con respecto a 2014
por este motivo”, indica Lagos, profesor
HI-RKIRMIVuEHI1MRIVuEHIPE4SRXM½GME
Universidad Católica.
Las perspectivas que manejan los gremios que agrupan a empresas proveedoras y de servicios tampoco son positivas, ya que asumen que 2016 será aún
más complejo que el año pasado.
“Estamos en un período en que hay
que continuar con todos los esfuerzos y
KIWXMSRIWTEVELEGIVI½GMIRXIWRYIWXVSW
procesos y proteger nuestros márgenes.
Tal como se ha mencionado reiterativamente, tenemos que ser capaces de
mejorar nuestra productividad a niveles
similares de los países mineros desarrollados como Australia, Estados Unidos, y
Canadá”, enfatiza Pascual Veiga.
En la búsqueda de un cluster
“La construcción de un cluster de clase
mundial chileno en servicios y bienes
para la minería pasa por tener un poder
exportador fuerte, que subsista aún ante
la falta de demanda nacional”.
Gustavo Lagos,
académico de la Universidad Católica.
Otro tema pendiente de larga data es el
llamado cluster minero, un objetivo que
no ha avanzado todo lo que la industria
hubiera querido. La escasa experiencia
de los proveedores locales al compararla con otras naciones mineras como
Australia, por ejemplo, condice con las
MRWY½GMIRGMEW UYI ER QERXMIRIR IWXEW
empresas al momento de hablar de un
cluster de clase mundial chileno en bienes y servicios para la minería.
“Debemos transformarnos en proveedores de clase mundial. Pensar como
país y no sólo a nivel de empresa para
lograr exportar experiencias y un trabajo real de cluster. Es importante entender que la minería en Chile no es
sólo de las empresas mineras, sino de
la unión de muchas otras empresas muy
diversas en productos y servicios”, precisa Denny Salas, de Sutmin.
En este sentido, la innovación tecnológica cobra especial importancia para un
WIGXSV UYI EGSWXYQFVE E EYXSHI½RMVWI
como de “clase mundial”. Sin embargo,
en la práctica, la innovación parece no
ser un objetivo prioritario. De acuerdo
a un estudio realizado en 2013 por la
consultora Virtual Consulting International, sólo el 19% de los ejecutivos de las
mayores compañías mineras del mundo
que fueron encuestados consideró que
la innovación es necesaria para su éxito.
Cuando se realizó la misma pregunta a empresas de servicios para la minería, el 75%
señaló que la innovación es un aspecto fundamental, lo que demuestra el propósito
transformador que pretenden potenciar
los proveedores en sus procesos.
No obstante, de acuerdo a datos de una
investigación realizada por Fundación
Chile, sólo el 34% de los proveedores
exportó productos y/o servicios durante 2012, y para la mayoría de las empresas las exportaciones representaron
menos del 10% de sus ventas totales.
Para Gustavo Lagos, las empresas que
exportan bienes y servicios para la minería no han crecido sustancialmente
desde el año 2010, por lo que se mantienen cerca de 300 empresas proveedoras
nacionales realizando cargas al exterior.
“Se considera que el cluster será importante en términos exportadores (de clase
mundial) cuando sea capaz de exportar varios miles de millones de dólares por año.
Los australianos exportan cerca de US$
10.000 millones por año en este rubro, es
decir, 18 veces más que Chile”, agrega.
Con estos retos pendientes, las empresas de bienes y servicios reconocen que
se deben impulsar nuevas estrategias
nme 8 marzo
REP PROOVE 6-9.indd 8
07-03-16 17:44
Ideando estrategias
Más allá de la coyuntura, dirigentes del
gremio y expertos coinciden en que los
proveedores de la minería en Chile son
un sector de la industria con alta proyección. El hecho de que, según datos de
Fundación Chile, el empleo generado por
el sector aumentó un 43% entre 2010 y
2012, y que un 35% de los proveedores
vendió más de 100.000 UF durante el año
2012, son cifras que hablan por sí solas.
“Por las razones actuales y la carencia o
FENEVIEPHITVS]IGXSWQMRIVSWIRQEVcha, hace ver un año poco activo, con
empresas del área de proveedores que
Foto: Codelco
para potenciar una verdadera plataforma de proveedores.
“Tenemos que lograr potenciar políticas
que incentiven a los mineros nacionales tanto estatales como privados, que
TVI½IVEREPSQIRSWIRYRTSVGIRXENI
relevante, los productos y servicios de
IQTVIWEWREGMSREPIW]SHI½PMEPIWQYPtinacionales instaladas en Chile. Estamos
convencidos que la minería y la industria proveedora que se ha desarrollado
EPVIHIHSV HI IPPE IW HI PS QINSV UYI
XIRIQSWIRRYIWXVSTEuW²E½VQEIPTVIsidente de Aprimin, Pascual Veiga.
De acuerdo al académico de la Universidad Católica, Gustavo Lagos, el cluster
minero chileno está compuesto básicamente por tres tipos de empresas: en priQIVPYKEVI\XVERNIVEWGSRKVERGETEGMHEH
tecnológica que le venden a la minería
nacional; en segundo lugar, empresas chilenas que le venden a la minería nacional;
y en tercer lugar, empresas chilenas que
además de vender bienes y servicios a la
minería nacional, exportan sus productos.
“Es este tercer tipo de empresas la que
se quiere potenciar, y para ello es preciso llevar a algunos de los proveedores
del tipo 2 a exportar y hacer alianzas
entre empresas tipo 2 y 3 con empresas del tipo 1 para realizar envíos al
exterior. La construcción de un cluster
de clase mundial chileno en servicios y
bienes para la minería pasa por tener un
poder exportador fuerte, que subsista
aún ante la falta de demanda nacional”,
detalla Gustavo Lagos.
entrarán o acrecentarán sus problemas
económicos. Sin embargo, también se generan nuevas oportunidades en potenciar las áreas de automatización, control
y todo aquello que vaya en dirección a
un ahorro de costos y aumentar producción”, señala Denny Salas de Sutmin.
Otra arista relevante es la de los estímulos en medio de este escenario comTPINS %Wu PS HIXEPPE +YWXEZS 0EKSW EP
considerar interesante “explorar incentivos del Estado para aquellas mineras
que logren alianzas de largo plazo con
proveedores dirigidas a crear servicios
y bienes de clase mundial exportados”.
Es así como el sector de proveedores
de la minería espera consolidar su crecimiento, una vez que se estabilice el
sector. Mientras tanto, tal como indica
el presidente de Aprimin, Pascual Veiga,
“hay que continuar potenciando la innovación no sólo de procesos, sino especialmente de tecnología y desarrollo
cualitativos de productos chilenos en
una colaboración entre la industria, los
proveedores, centros de investigación y
la academia”.
Las perspectivas que manejan los gremios
que agrupan a empresas proveedoras
y de servicios tampoco son positivas,
ya que asumen que 2016 será aún
más complejo que el año pasado.
marzo 9 nme
REP PROOVE 6-9.indd 9
07-03-16 17:44
Foto: Codelco
Productividad, la respuesta
de la minería en tiempos difíciles
Las principales compañías mineras han puesto el foco en mejorar la
productividad, elevar la eficiencia, y optimizar los procesos, entre otras
muchas medidas, para enfrentar el actual escenario de precios bajos. ¿Una
reacción tardía? “Más vale tarde que nunca”, responde la industria.
Joaquín Ruiz
nm
nme
nm
me
e 10
10 m
ma
marzo
arz
rz
rzo
zo
o
MIN PRODUC 10-12.indd 10
08-03-16 16:03
Foto: Consejo Minero
ace sólo dos años, el cobre iniciaba 2014 con precios que superaban
tranquilamente los US$ 3,30 la libra. Y
pese a que ya por esos días se advertía
una tendencia decreciente, pocos imaginaron que solo 24 meses más tarde el
metal se cotizaría por debajo de los dos
dólares, profundizando una sensación
de crisis que dominó el sector durante
prácticamente todo el año pasado.
Si bien el cobre ha mostrado una cierta
recuperación en estos primeros días de
marzo que han vuelto a ubicar su precio
por sobre los dos dólares, el metal rojo
sigue estando muy lejos de valores tranquilizadores para la industria. La misma
industria que sólo parecía estar preocupada por producir cuando el precio le
favorecía, sin inquietarse demasiado por
otros factores como la contención de
GSWXSW]PEI½GMIRGMEUYILS]WuWSRXImas prioritarios.
La historia se ha encargado de demostrar que el negocio de los commodities,
y por cierto el del cobre, es cíclica. Así
como hay tiempos de abundancia y de
rentabilidad soñada, hay otros períodos
HIZEGEW¾EGEWHSRHIPSWENYWXIWHIWTMdos, recortes de producción y planes de
urgencia están a la orden del día.
En este escenario, las principales compañías del sector han puesto el foco
en mejorar la productividad, elevar la
I½GMIRGME ] STXMQM^EV PSW TVSGIWSW
entre otras muchas medidas, para enfrentar un panorama deprimido, con
pocos signos de recuperación en el
cor to plazo.
“En un momento de menores precios, la
minería ha asumido el compromiso de
mejorar la productividad. Alguien puede
decir es tarde. Pero más vale tarde que
nunca. Y aunque sea más por necesidad
que por virtud, nos parece que es una
decisión correcta”, aseguró el presidente del Consejo Minero, Joaquín Villarino,
durante un seminario organizado por el
gremio (ver recuadro).
El dirigente gremial reconoció que muchas veces “cuesta, con las urgencias
cotidianas, levantar la vista y pensar en
el largo plazo”, pero aseguró que “prácticamente todo el trabajo” realizado
por el Consejo durante el año pasado
estuvo enfocado en la elaboración de
Foto: Ministerio de Hacienda
H
Joaquín Villarino,
presidente del Consejo Minero.
Rodrigo Valdés,
ministro de Hacienda.
propuestas para participar en el debate de las reformas que ha impulsado el
gobierno. Sin embargo, se lamentó de la
falta de preparación y de conocimiento
de sus interlocutores.
“Nos encontramos muy a nuestro pesar con que actores muy relevantes
del acontecer nacional sabían poco de
minería, o sabían mal de minería y por
lo tanto muchas de las decisiones que
se estaban tomando tenían un mal fundamento. Estaban basados en juicios
fundados en información incorrecta”,
expresó.
inversiones, con pérdidas de puestos
de trabajo, ajustes de costes, y eventuales cierres de faenas. Pero no obstante lo anterior, Villarino aseguró que
la industria minera seguirá siendo la
principal industria del país por muchos
años, lo que en su opinión abre espacios para una nueva agenda de trabajo
multisectorial.
“Creemos que esto constituye una
gran oportunidad para que podamos
construir un pacto multisectorial sobre
productividad que nos lleve a una nueva
agenda, distinta a las anteriores, en que
todos hablemos de un mismo concepto
de productividad”, agregó.
Foco en la productividad
De todos modos, Villarino reconoció
que el desfavorable escenario externo
debe ser entendido como una “oportunidad”, para poner el foco en la productividad y en el crecimiento, dos de las
palabras que la industria más menciona
en los últimos meses.
“Es una mala noticia que haya una baja
cotización de la libra de cobre que nos
obliga a hacer aún más austero en el
QERINSHIPEWGYIRXEW½WGEPIW4IVSIWXS
no nos condena, más bien nos empuja
hacia nuevos desafíos como son, entre
otros, mejorar la productividad, que en
minería, por ejemplo, es 45% más mala
o peor que la de países como Estados
Unidos y Australia en la misma actividad
(…) Con una minería más productiva,
ganamos todos”, señaló.
El presidente del Consejo Minero advirtió que la minería “pasa y probablemente pasará por los próximos años” un
período complejo, con postergación de
Gobierno llama a adaptarse
Lo cierto es que los bajos precios del
cobre llegaron para quedarse. Al menos
por un buen tiempo más, según reconoce el gobierno, que ya asumió que el
llamado “superciclo” que elevó la cotización del metal rojo a cifras históricas, ya
es parte del pasado.
“Tenemos que suponer que los precios del cobre sufren ciclos que no
son para siempre. Pero en el cor to
plazo, tenemos que acostumbrarnos,
adaptarnos, y buscar maneras de vivir
mejor con precios del cobre que van a
ser más bajos”, advir tió el ministro de
Hacienda, Rodrigo Valdés, en el marco
del seminario organizado por el Consejo Minero.
Siguiendo la tónica de la industria minera, el titular de Hacienda ha puesto énfasis en la productividad y el crecimiento,
dos temas que también preocupan al
marzo 11 nme
MIN PRODUC 10-12.indd 11
08-03-16 16:03
'HVDItRSDUDODLQGXVWULD\HOÀVFR
En opinión de Valdés, el complejo
escenario que enfrenta la industria
minera obliga a potenciar esfuerzos
estratégicos entre las administraciones y los trabajadores para contener
los costos, aumentar la innovación y
elevar la productividad. Pero también
admitió que es un desafío mayor para
IP½WGSUYILEXIRMHSYREQIVQEMQpor tante por este menor apor te de
la minería. Incluso, reconoció que ese
apor te podría simplemente desaparecer durante este año.
±0EZIVHEHIWUYIIWXIEySTEVEIP½WGS
los ingresos del cobre, aparte de lo que
es la Ley Reservada que va a las Fuerzas
Armadas, serán cercanos a cero”, se lamentó el ministro.
Sin embargo, Valdés aseguró que Chile
está preparado para este escenario por
IP GSQTSVXEQMIRXS ½WGEP ] QEGVSIGSnómico que “en muchas áreas nos ayudan”, destacó.
“Tenemos muchas fortalezas, pero tenemos que adaptarnos a esta realidad
(…) Creo que Chile ha dado muestras
HIUYIWITYIHIEHETXEVEIWXEWHM½GYPtades. Chile ha crecido y se ha desarrollado con precios más bajos incluso a los
que vemos hoy”, agregó.
Valdés reiteró que estos tiempos de di½GYPXEH HIFIR WIV XSQEHSW GSQS±YRE
oportunidad para poner una pausa en
algunos temas y concentrarnos en aquellas cosas que son más relevantes. Y en
eso está recuperar el crecimiento y elevar la productividad, sin duda. Esta tiene
que ser una de nuestras prioridades. Y
Masivo seminario-desayuno
La decisión del Consejo Minero de suspender su tradicional cena anual
y reemplazarla por un seminario-desayuno con presentaciones de expositores y un panel de discusión no sorprendió a la industria. El deprimido panorama minero afectado por los bajos precios del cobre hizo
pensar a muchos que la decisión del gremio respondía a este contexto.
Sin embargo, desde el mismo Consejo aclararon que la suspensión de
la cena se había decidido 10 meses antes, y no necesariamente motivados por los planes de austeridad y de control de costos que se han
impuesto en el último tiempo en el sector. La idea era cambiar el formato, “innovando en la forma de participar que tienen los gremios en
el debate público”, según explicó el presidente Ejecutivo del Consejo
Minero, Joaquín Villarino.
El resultado fue un masivo encuentro empresarial que puso el acento en la productividad, competitividad e innovación, temas ejes que
cruzaron todo el seminario, denominado “Otra mirada para el crecimiento”.
Foto: Joaquín Ruiz
gobierno, dado los bajos precios -que
LER MQTEGXEHS IR PEW GYIRXEW ½WGEPIW
y el contexto externo que no ayuda a
mirar con optimismo el futuro.
“Es cierto que hoy tenemos un escenario económico más complejo. El mundo
se ve menos favorable, hay varias amenazas, y lamentablemente algunas amenazas ya se han materializado. Lo que
está pasando en China es una realidad
compleja para nosotros”, reconoció el
ministro, aludiendo a la desaceleración
del gigante asiático y el giro que ha dado
ese país respecto a su estrategia económica.
El masivo desayuno del Consejo Minero reemplazó
a la tradicional cena anual del gremio.
esto es compatible con avanzar con una
sociedad más integrada, más igualitaria”,
añadió.
“Mejorar la productividad es una tarea
WMKRM½GERXI]RSWIGSRWMKYIRVIWYPXEHSW
de un día para otro. Creo que es muy
parecido a plantar un arbolito. Cuando
uno planta un árbol chico, toma tiempo
que crezca. Hay que cuidarlo y regarlo
]EP½REPHEWSQFVE]HEJVYXSW=IWSW
frutos, que son los frutos de la producXMZMHEHXMIRIRUYIFIRI½GMEVEXSHSW=
ése es el desafío”, concluyó.
nme 12 marzo
MIN PRODUC 10-12.indd 12
08-03-16 16:03
Avisos.indd 1
07-03-16 14:51
Foto: Guillaume Boisseau
Morenci, mina de cobre de propiedad de
Freeport ubicada en Arizona, Estados Unidos.
Freeport-McMoRan:
Sumándose a la ola de cambios
Con la entrada en operaciones de la expansión de la mina Cerro Verde en Perú
y el acceso a partir de este año a mineral de más alta ley en la mina Grasberg,
en Indonesia, Freeport-McMoRan espera repuntar sus volúmenes de venta de
cobre en 2,36 millones de ton durante este año, pese a los cambios y problemas
que está experimentando la mina El Abra ubicada en Chile.
Daniela Tapia
R
educción de capitales, viraje de timón en los planes de inversión y recorte de dotación propia, son algunas de
PEWEGGMSRIWUYILERXSQEHSPEW½VQEW
mineras, preocupadas por el complejo
escenario generado por la baja en la cotización del cobre.
Ahora fue el turno de la compañía estadounidense Freeport-McMoRan que
a mediados del año pasado anunció la
QSHM½GEGMzRHIWYWTPERIWHIGETMXEP]
operación en respuesta a la caída de los
precios del metal rojo.
%Wu E XVEZqW HI IWXE ETYIWXE PE ½VQE
busca reducir la producción de cobre de
2016 y 2017 en aproximadamente 150
millones de libras (68.039 millones de
ton) en relación a las estimaciones informadas en julio de 2015, principalmente
como resultado de la reducción en las
tasas de operación en varias de las operaciones mineras de Freeport (FCX).
“Los cambios permitirán a FCX lograr
menores costos de operación, mayores
I½GMIRGMEW ] TVIWIVZEV VIGYVWSW TEVE
mejores condiciones de mercado que
se anticipan para el largo plazo”, sostuvo
la compañía públicamente.
Mientras que en El Abra, mina ubicada en
la Región de Antofagasta en Chile, la tasa
de explotación y apilamiento de mineral
se reducirá en un 50%, situación que obligó a tomar la decisión de desvincular a
alrededor de 650 trabajadores.
De acuerdo a la compañía, esta medida obedece a reducir los costos y los
requerimientos de inversiones de capital en el corto plazo, permitir una vida
más larga de la mina para sus reservas
existentes de mineral Sulfolix, además
de una mejor oportunidad para vender
su producción de cobre en las mejores
condiciones de mercado que se podrían
dar a futuro.
Pero en los últimos meses ha sido recurrente el rumor de un cambio de dueño de la faena. Y uno de los interesados
podría ser Codelco, empresa que ya tiene el 49% de la propiedad de El Abra y
que por ahora no descarta la idea de
adquirir el otro 51% que aún pertenece
a Freeport, según reconoció el propio
presidente de la estatal, Nelson Pizarro.
“Podría ser una oportunidad si El Abra
quiere vender a un precio razonable y si
nosotros no tenemos mejores alternativas”, dijo Pizarro a inicios de año, consultado por periodistas.
Sus planes inmediatos
Pese a los vaivenes del escenario minero, las proyecciones no son del todo pesimistas. Así, según su último reporte, las
ventas consolidadas de cobre de Freeport McMoRan totalizaron 1,85 millón
de ton en 2015, mientras que para este
año la proyección de la compañía es alcanzar 2,36 millones de ton.
Y es que a pesar de las preocupaciones
sobre la economía global, y en particular
la debilidad de la economía china y un
mercado del cobre “esencialmente balanGIEHS²PEGSQTEyuELEE½VQEHSWYGSR½ER^EIRPEWTVS]IGGMSRIWHIPEVKSTPE^S
para el precio del metal rojo, basada en
nme 14 marzo
MIN FREE 14-15.indd 14
07-03-16 17:45
los fundamentos de la oferta y la demanda global.
A esto se suma que uno de sus hitos
más recientes es la puesta en marcha del
proyecto de ampliación de la mina Cerro Verde, ubicada en Arequipa, Perú, que
inició sus operaciones en septiembre del
año pasado y que podría alcanzar su plena capacidad a principios de este año.
El proyecto incrementa la capacidad de
las instalaciones de concentración de
120.000 tpd de mineral a 360.000 tpd,
permitiendo así un aumento en la producción anual de aproximadamente 600
millones de libras de cobre (unas 270.000
toneladas) y 15 millones de libras de molibdeno a partir de este año, según lo precisa la minera en su informe de resultados.
“Esta ampliación permitirá a Cerro Verde
GSRXVMFYMVGSRWMKRM½GEXMZSW¾YNSWHIIJIGXMZSIRPSWTVz\MQSWEySWETEVXMVHIWY
rentable operación de gran escala y larga
duración. Esto, combinado con un sólido
desempeño operacional en las faenas de
%QqVMGE HIP 2SVXI ] ÅJVMGE NYRXS GSR
QINSVIWPI]IWTVIZMWXEWIRPEQMRE+VEWberg, situada en Indonesia, hacia la segunHEQMXEHHIIWXIEyS²WSWXYZSPE½VQE
¿Otra buena noticia? En cuanto a sus
operaciones de cobre en Sudamérica
-Cerro Verde, con una participación del
53,56%, y El Abra-, Freeport espera que
IR PEW ZIRXEW HI GSFVI WIER GIVcanas a las 590.000 ton, es decir, 1.300
millones de libras en comparación con
las 395.000 ton obtenidas en 2015.
El proyecto de ampliación de la mina
Cerro Verde, ubicada en Arequipa,
Perú, inició sus operaciones en septiembre
del año pasado y se espera que alcance plena
capacidad a principios de este año.
marzo 15 nme
MIN FREE 14-15.indd 15
09-03-16 11:00
Foto: Minera El Abra
Actuales instalaciones de
la faena minera El Abra.
La ampliación de El Abra
en compás de espera
Pese a que el proyecto deberá esperar mejores condiciones para retomar
sus estudios técnicos, la iniciativa no ha sido desechada de la cartera de
proyectos de sus compañías desarrolladoras, Freeport-McMoRan y Codelco.
Daniela Tapia
L
a más reciente actualización de la
cartera de proyectos mineros elaborada por Cochilco para el período 20152024 en Chile da cuenta de 42 iniciativas por un total de US$ 77.300 millones.
Sin embargo, solo 24 proyectos están
GEPM½GEHSW GSQS±TVSFEFPIW² WYQERHS
US$ 31.453 millones, lo que representa
un 40% de toda la cartera.
Frente a este panorama un tanto desolador, destaca la detención de una serie
de obras que en el último tiempo han
WEPMHS HI IWE GEXIKSVuE HI±TVSFEFPIW²
como el proyecto de ampliación de la
mina El Abra, llamada Mill Project.
Esta iniciativa busca mantener la continuidad operacional del actual yacimiento -controlado por Freeport McMoRan
(51%) y Codelco (49%)-, tratando las
nuevas reservas de sulfuros primarios
que emergen a medida que se extinguen los recursos lixiviables, prolongando así la vida útil de sus operaciones.
Asimismo, el proyecto considera una
nueva planta para procesar entre
150.000 y 200.000 toneladas diarias de
mineral, lo que permitiría una producción cercana a las 300.000 toneladas
ERYEPIWHIGSFVI½RSIRGSRGIRXVEHSW
doblando la actual producción de cobre
en cátodos.
Incluso, de acuerdo a las últimas actualizaciones hechas públicas por la compañía, ese margen de crecimiento podría
ser aún mayor, ya que los resultados de
la campaña exploratoria realizada en
2012 indicaban que el proyecto tendría
un potencial de producción por sobre
las 450.000 toneladas de cobre en concentrados.
Sin embargo, el proyecto deberá esperar mejores condiciones para retomar
sus estudios técnicos, aunque los controladores de El Abra han aclarado que
la iniciativa no ha sido desechada de la
cartera de proyectos.
¿Cuál será el futuro de esta iniciativa
que pretende darle nuevos bríos al alicaído escenario minero local? Difícil saberlo, ya que en los últimos meses ha
sido recurrente el rumor de un cambio
de dueño de la faena El Abra, donde
Codelco podría tomar el control total
del yacimiento, según lo que ha dejado
entrever públicamente su propio presidente Ejecutivo, Nelson Pizarro.
Ampliación El Abra
Ubicación:
76 kms al norte de la comuna
de Calama, en la provincia
de El Loa, a una altitud
promedio de 4.180 m.s.n.m.
Propiedad:
51% Freeport-McMoRan
(FCX), 49% Codelco.
Producción estimada:
Entre 150.000 tpd a 200.000
tpd de mineral sulfurado.
Inversión:
US$ 5.000 millones.
Etapa actual:
El proyecto se encuentra
momentáneamente detenido,
a la espera de mejores
condiciones para retomar
sus estudios técnicos.
nme 16 marzo
MIN ABRA 16.indd 16
07-03-16 17:45
Avisos.indd 1
07-03-16 14:53
Foto: Codelco
Proveedores mineros buscan
ponerse al día con la sustentabilidad
Pese a algunos avances, las empresas proveedoras reconocen
que hay todavía un largo camino por recorrer para instalar una
dimensión social, ambiental o de sustentabilidad en su quehacer.
Joaquín Ruiz
P
oco antes que cinco conocidos exper tos en temas
ambientales y de responsabilidad social comenzaran un
debate sobre sustentabilidad en la minería, el moderador
del encuentro advir tió que no había representantes de
empresas proveedoras en el panel. El comentario venía
al caso, pues era la propia Asociación de Proveedoras
Industriales de la Minería, Aprimin, la que convocaba al
debate.
La respuesta del gremio no se dejó esperar: “venimos a escuchar”. Y eso es lo que está haciendo Aprimin, pues hasta
ahora, pese a algunos avances, reconocen que hay todavía un
largo camino por recorrer para instalar una dimensión social,
ambiental o de sustentabilidad en el quehacer de sus propios
asociados.
“Algunas de nuestras empresas ya han comenzado a gestionar
con esta nueva óptica. Otras, sin embargo, aún desconocen lo
que aplica al concepto de sustentabilidad, y lo que ello implica.
Por eso estamos aquí, porque queremos aportar al desarrollo
sostenible del país y eso implica mirar íntegra y holísticamente
cómo estamos gestionando hoy nuestros negocios”, explicó el
presidente de Aprimin, Pascual Veiga, en el marco del encuentro (ver recuadro).
nme 18 marzo
MIN SUSTE 18-19.indd 18
08-03-16 15:57
Gestión sustentable
Analizar el avance en materias como
la gestión de la sustentabilidad, para así
contar con “estándares de gestión mínimos”, son parte de los objetivos que
se han autoimpuesto las empresas proveedoras.
En este sentido, buscan abrir un espacio de debate para compartir conocimientos y mejores prácticas en los tres
grandes pilares de la sustentabilidad que
LEHI½RMHS%TVMQMRPEHMQIRWMzR±IGSnómica, social y ambiental”.
La idea es generar una instancia a través
de la cual se puedan abordar los nuevos desafíos que enfrentan las empresas
proveedoras de la minería, “considerando que en la actualidad existe en la
industria una mayor preocupación por
evaluar la gestión de la sustentabilidad
en la cadena de valor completa de la
minería”, según destaca la presidenta del
Comité de Sustentabilidad de Aprimin,
Karin Eggers.
“Hace tres años tuvimos un primer encuentro, creando una primera instancia
con un seminario de responsabilidad
social empresarial, en la cual discutimos,
VI¾I\MSREQSW EGIVGE HI PE WYWXIRXEbilidad. Nos dimos cuenta ahí que ya
había algunas empresas que estaban
gestionando, que tenían buenas prácticas, y que tenían algunos programas. No
obstante, había otras y todavía tenemos
otras que no conocían el concepto y
estaban muy confundidas por cómo comenzar”, explica Eggers.
Con este diagnóstico, Aprimin decidió
crear una instancia gremial que permitiera apoyar a las empresas socias en el
avance de su nivel de gestión sustentable. Todo con la idea de generar un
espacio para compartir conocimientos
] QINSVIW TVjGXMGEW )R HI½RMXMZE TEVE
aprender, “sin miedo a decir ‘no sé’”,
como reconoce la presidenta del Comité de Sustentabilidad del gremio.
Óptica más integral
¿Pero qué se necesita para que las empresas del sector minero puedan de
verdad ser consideradas como “sustentables”? Para el gerente de Sustentabilidad
y Relaciones Institucionales de Codelco,
Jorge Lagos, alcanzar ese objetivo involucra cambios necesarios para lograr “un
IRXSVRSHIRIKSGMSGSR½EFPI²
En otras palabras, involucra mirar el
negocio con una óptica más integral,
considerando diferentes dimensiones, y
que necesariamente debe ir más allá de
perseguir la rentabilidad de la empresa,
reconoce el ejecutivo.
“Hay que tener una óptica un poco
más grande que involucre una mirada de los proyectos de manera temprana. Diseñar proyectos razonables
desde el origen; no poner parches,
porque se notan y se ven feo. Debemos ser empresas responsables y ser
par te de esta transformación. Y debemos adoptar un modelo que vaya
más allá de la utilidad, aunque duela”,
explica Lagos.
Pero no sólo eso. Las empresas también
deben aprender a relacionarse con su
entorno, respetando el medio ambiente y las comunidades, “y ser parte de la
construcción de una mejor sociedad”,
concluye el ejecutivo de Codelco.
Panel de debate sobre sustentabilidad
Conscientes de que es un tema pendiente para sus asociados, Aprimin organizó un panel de discusión enfocado en la sustentabilidad.
El encuentro consideró la participación de diferentes expertos y
representantes de la industria, quienes analizaron el impacto de la
sustentabilidad en el negocio minero centrando el debate en lo que
esperan los clientes mineros de sus proveedores en estos temas.
En el panel participó el presidente Ejecutivo del Consejo Minero,
Joaquín Villarino; el socio fundador de la consultora Acción RSE,
Javier Cox; el vicepresidente de Asuntos Corporativos y de Sustentabilidad de Colbún, Juan Pablo Schaeffer; y la vicepresidenta de
Asuntos Corporativos y Sostenibilidad de la minera Sierra Gorda,
Ana Zúñiga, además del gerente General de Acción RSE, Ignacio
Larraechea, quien moderó el debate.
Foto: Felipe Pinto
El desafío es particularmente complejo
en estos días, ya que la atención está
en otros asuntos que parecen ser más
urgentes de resolver, como el complicado panorama que enfrentan las empresas por la importante baja que ha
sufrido el precio de los metales en el
último tiempo.
“Las empresas proveedoras de la minería deben hacer frente al desafío de la
reducción de costos y del aumento de
la productividad que el sector requiere.
7I ZIR HIWE½EHEW TIVQERIRXIQIRXI E
actuar cada vez más en forma transparente y ética; hacerse cargo de sus externalidades, positivas y negativas, tanto
en la dimensión económica, como social
y ambiental, así como de dialogar con
los grupos de interés, entre muchos
otros temas”, agregó Veiga.
El panel de debate organizado por Aprimin.
marzo 19 nme
MIN SUSTE 18-19.indd 19
08-03-16 15:57
Foto: Codelco
Recursos, Reservas y Planes Mineros:
De viejas prácticas
y nuevas tecnologías
Aplicar herramientas que permitan obtener mayor eficiencia en una
operación minera es un propósito clave para el sector, más aún en
tiempos complejos como los que se viven actualmente. Éste será
precisamente el tema central de un seminario que organizará la
Comisión Minera en abril próximo, en Santiago.
Camila Morales
E
s un hecho que las variaciones
del mercado mundial y las normativas
medioambientales locales han incidido
IR PE IZSPYGMzR HI PE TPERM½GEGMzR QMnera de las empresas pertenecientes
al sector. En mayor o menor grado, las
compañías del rubro han debido crear
estrategias para continuar las operaciones de un yacimiento en medio de un
escenario cuesta arriba.
Es por eso que generar espacios de
análisis y discusión sobre estrategias
para optimizar los procesos de la minería se ha vuelto una práctica habitual en
la industria. Bajo este tenor, la Comisión
'EPM½GEHSVE HI 'SQTIXIRGMEW IR 6IGYVWSW ] 6IWIVZEW 1MRIVEW 'SQMWMzR
1MRIVE VIEPM^EVj IP WIQMREVMS ±6IGYVWSW6IWIVZEW]4PERIW1MRIVSW²
En opinión de Hans Göpfert, vicepreWMHIRXI HI PE 'SQMWMzR 1MRIVE IP IRGYIRXVS ±FYWGE TVIWIRXEV YR GSRNYRXS
de visiones que vienen desde diferentes
jQFMXSW ] VI¾INER KVEHSW ZEVMEFPIW HI
madurez de las aplicaciones de modo de
GSQFMREVPEMRRSZEGMzRGSRPEGSR½EFMPMdad, que son ambos aspectos de la mayor importancia para el buen desarrollo
HIPSWIQTVIRHMQMIRXSWQMRIVSW²
De esta manera, tomando en cuenta que
la calidad del yacimiento y la forma de explotarlo son parte de los factores que más
MR¾Y]IRIRPETPERM½GEGMzRTVIZMEIPIZIRto a realizarse el próximo 14 de abril dará
a conocer herramientas tecnológicas que
sean útiles para establecer de la mejor forma tanto la cantidad de mineral, como el
diseño para extraer esta riqueza.
±)RIWXIWIQMREVMSWITVIWIRXEVjREPKYnas herramientas novedosas, intentando
combinar desarrollos incipientes con
aplicaciones maduras. De ese modo, se
espera que los asistentes se familiaricen
con las mejores prácticas actuales y al
mismo tiempo visualicen las innovaciones que estarán disponibles en el futuVS²I\TPMGE,ERW+}TJIVX
4EVE XIRIV YRE ZMWMzR TERSVjQMGE HI
las novedades implementadas en el
análisis de recursos minerales y la
posterior extracción de reservas mineras, la actividad organizada por la
'SQMWMzR 1MRIVE MRGPYMVj XVEFENSW MRcubados en las universidades, con el
propósito de analizar las innovaciones
que se están gestando desde diferentes perspectivas.
nme 20 marzo
MIN COMI 20-21.indd 20
08-03-16 15:58
mejorar las estimaciones de recursos
y el análisis de procesos QA/QC para
poblar una base geominerometalúrgica.
“Se ha esbozado el alcance global de los
temas y se ha tomado contacto con las
personas y empresas que debiesen tener
algo importante que entregar en las difeVIRXIWjVIEW=ELIQSWVIGMFMHSPEGSR½Vmación de gran parte de los expositores
que invitamos y se está confeccionando la
agenda detallada del seminario en base al
campo de especialización y al tópico que
WI LE HI½RMHS GSR GEHE YRS² TVIGMWE IP
vicepresidente de la Comisión Minera.
Con estas temáticas y la organización
de foros técnicos, la Comisión Minera
espera consolidarse como un lugar de
encuentro entre profesionales y experXSWHIPjVIEHIPETPERM½GEGMzR]VIWIVvas en tiempos en que la baja de los
precios de los commodities mantiene
IR EPIVXE PSW TVSGIWSW HI TPERM½GEGMzR
y procedimiento de todas las empresas
de la industria.
Foto: Comisión Minera
“Esperamos que el seminario ofrezca
una adecuada mezcla de aplicaciones.
Entre los expositores tendremos exponentes de la academia, de proveedores
de soluciones tecnológicas (software)
IWTIGu½GEW HI IQTVIWEW GSRWYPXSVEW
especializadas y de empresas mineras.
De modo que habrá oportunidad para
analizar los temas desde diferentes experiencias y facetas, lo que siempre es
enriquecedor”, señala Hans Göpfert.
Hasta la fecha, la organización ha con½VQEHSPETEVXMGMTEGMzRHII\TIVXSWHI
empresas e instituciones como Codelco,
Antofagasta Minerals, Kinross Maricunga,
Tetra Tech Metalica, Redco y la UniversiHEHHI'LMPIGSRIP½RHIIRXVIKEV±YRE
visión integral de las aristas a debatir”.
En relación a las temáticas que se discutirán, destaca el procedimiento de
TPERM½GEGMzRQMRIVETEVEPEHIGPEVEGMzR
de recursos y reservas, el modelo de
VMIWKSTEVEPETPERM½GEGMzRHIQIHMERS
plazo, las restituciones geométricas para
Hans Göpfert,
vicepresidente de la Comisión Minera.
marzo 21 nme
MIN COMI 20-21.indd 21
08-03-16 15:58
Foto: Codelco
Mesa redonda en Expomin
Con el foco en la Reforma Laboral
Como es habitual, los temas que se debatirán en los diferentes
seminarios que se realizarán en Expomin tendrán directa relación con
la coyuntura nacional. En este sentido, la Reforma Laboral impulsada
por el gobierno de la Presidenta Bachelet, será foco de análisis por
parte de expertos y representantes de la industria.
Camila Morales
E
s una de las reformas más emblemáticas del actual gobierno de la Presidenta Michelle Bachelet. La Reforma
Laboral constituye, en palabras de la
mandataria, “uno de los cambios radicales que Chile necesita”. Sin embargo,
no todos están convencidos de esta
E½VQEGMzR]EUYIPEVIJSVQEERIRIWtado de proyecto, sigue generando diferencias y un intenso debate en sectores
productivos como el minero.
Basta recordar la postura del Consejo Minero en mayo del año pasado
respecto a esta propuesta de cambio.
7IKR IWXI SVKERMWQS IP TEuW TIVHIVuE
US$ 3.000 millones en el rubro minero
por el impacto de la Reforma Laboral,
TVS]IGGMzRUYIJYIVIWTEPHEHETSVYRE
parte importante de esta industria.
Mientras tanto, autoridades de gobierno
y algunos expertos en el ámbito laboral
avalan esta reforma al considerarla un
paso para alcanzar un equilibrio en las
relaciones entre empresas y trabajadores, además de mejorar la calidad y productividad del empleo, y perfeccionar la
RIKSGMEGMzRGSPIGXMZE
'SR PE VIJSVQE ER IR XVjQMXI IR IP
'SRKVIWS ½REPQIRXI ¡GYjRXS MRGMHMVj
IWXEXVERWJSVQEGMzRIRIPVYFVSQMRIVS#
Esta es la gran interrogante que pretende
HIWTINEV PE WIKYRHE ZIVWMzR HI PE QIWE
VIHSRHE±(IWEJuSW0EFSVEPIW]6IGYVWSW
,YQERSW IR 1MRIVuE² EGXMZMHEH UYI WI
desarrollará en el marco del XIV Congreso Internacional Expomin 2016.
%WuPSI\TPMGE0YMW0M^EQEEFSKEHSWSGMSHI0M^EQE]'uE]GLEMVQERHIIWXE
actividad que se caracterizará por cambiar el foco de interés en su segunda
ZIVWMzR7MIRIWXEQIWEVIHSRHE
EREPM^zPSWHIWEJuSWMRXIVRSWHIPjQFMXS
PEFSVEPIRPEQMRIVuEIWXIEySEQTPMEVj
IWXITVSTzWMXS]GIRXVEVjPEHMWGYWMzRIR
la reforma propuesta por el Ejecutivo.
“La mesa redonda que va en su segunda
ZIVWMzRIWXjSVMIRXEHEEPERjPMWMWHIEUYIPPSW EWTIGXSW UYI ½REPQIRXI WI ETVYIben en la Reforma Laboral. Por supuesto,
siempre los debates y el análisis con altura contribuirán a lograr conclusiones que
nme
n
me 22 marzo
MIN SEMI-EXPO 22-23.indd 22
07-03-16 17:45
QjW ] QINSV² TVIGMWE IP GLEMVQER HIP
encuentro.
Por estos días, los organizadores se
IRGYIRXVER XVEFENERHS IR YRE IXETE
HI±MRXIVGEQFMS HI STMRMSRIW² GSR HMferentes actores del sector, de manera
de asegurar la presencia en el debate
HI±ZMWMSRIW HMZIVKIRXIW² VIWTIGXS E PE
6IJSVQE0EFSVEPE½VQE0M^EQE
De esta manera, se busca que la mesa
redonda se transforme en “un espacio
necesario para acercar posiciones y
TVIZIRMVGSR¾MGXSWPSGYEPTEVIGIWIVPS
TVSTMGMSJVIRXIEYRIWGIREVMSGSRJYWS²
agrega el abogado.
La mesa redonda “Desafíos LaboraPIW ] 6IGYVWSW ,YQERSW IR 1MRIVuE²
WI VIEPM^EVj IR PE NSVREHE QEXMREP HIP
ZMIVRIW TSRMIRHS TYRXS ½REP E PEW
actividades del Congreso Internacional
Expomin 2016, que contempla diversos
foros, seminarios y talleres que se realizarán durante los 5 días que dura esta
tradicional feria minera que se realiza a
½RIWHIEFVMPIR7ERXMEKS
Foto: Luis Lizama
obviamente permitirían complementar, si
fuera necesario, algunos aspectos aproFEHSW½REPQIRXIIRHMGLEVIJSVQE²HItalla Lizama.
)P IRGYIRXVS UYI IWXj ½NEHS TEVE IP
viernes 29 de abril, abordará el proyecto
de ley que promete transformar el sistema de relaciones laborales y analizará
su impacto en las empresas mineras, en
QIHMS HI YR IWGIREVMS GSQTPINS TEVE
la industria.
Para el debate ya está comprometida la
participación de expertos en temas relaGMSREHSWEPELYIPKEWMRVIIQTPE^SKSGI
EYXSQjXMGSHIFIRI½GMSWGSPIGXMZSWTSV
E½PMEGMzRWMRHMGEP]TVSLMFMGMzRHII\XIRsión de los mismos al empleador.
“Me parece importante señalar que ante
YRIWGIREVMSXERGSQTPINSIMRGMIVXSWIría adecuado promover un gran acuerdo
entre las organizaciones sindicales y las
empresas para abordar estos temas. La
MRHYWXVMEHIWHIWMIQTVILEHIWEVVSPPEHS
IR WYW RIKSGMEGMSRIW GSPIGXMZEW PE ¾I\Mbilidad laboral necesaria para producir
La mesa redonda “Desafíos Laborales
y Recursos Humanos en Minería”
busca convertirse en “un espacio
necesario para acercar posiciones y
SUHYHQLUFRQÁLFWRVµVHJ~QGHVWDFD
/XLV/L]DPDFKDLUPDQGHHVWHHQFXHQWUR
marzo 23 nme
MIN SEMI-EXPO 22-23.indd 23
07-03-16 17:45
Cochilco revela alza en los costos
de operación de la gran minería
Los costos promedio directos de operación (cash cost C1) de la gran minería subieron 1,3 centavos de dólar la libra al tercer trimestre de 2015
-respecto de igual período del año anterior-, llegando a 155,7 centavos de
dólar la libra, según informó Cochilco.
Al medir el desempeño de las 19 mayores empresas mineras que representan el 90% de la producción nacional, Cochilco precisó que el alza en el
costo acumulado a septiembre se debe por aumentos en servicios y otros
gastos, unido a un menor crédito por subproductos. Sin embargo, el incremento fue en parte contrarrestado por los menores
costos en energía y combustibles, además de remuneraciones del personal.
“El actual escenario de precios bajos es preocupante para aquellas operaciones que han visto aumentar sus costos, ya que se ve
amenazada su competitividad y deben redoblar sus esfuerzos para disminuir los costos y generar utilidades”, indicó el vicepresidente Ejecutivo de Cochilco, Sergio Hernández.
Cotización del litio en 2016 sería un 47%
mayor al registrado el año pasado
En un contexto marcado por bajos precios de varios minerales, el litio asoma como
una excepción en el mercado de los commodities. Pese a que no existe un índice
que siga el precio del producto, desde la empresa corredora de bolsas EuroAmerica, destacan que la cotización del litio se encuentra por sobre los US$10.000 la
tonelada, lo que implica un precio un 47% superior a lo promediado durante 2015.
“Se espera que el crecimiento de la demanda del carbonato de litio utilizado en
las baterías se acelere hasta un 18% CAGR (tasa de crecimiento compuesta anual)
durante 2018-20, mientras que el hidróxido de litio crecería a 40% CAGR entre 20152020”, detalla un reporte de Banchile Inversiones.
KGHM y Sumitomo analizan mejoras
en la operación de Sierra Gorda
A mediados de febrero, ejecutivos de la polaca KGHM y de la japonesa
Sumitomo -con un 55% y 45% de participación en Sierra Gorda, respectivamente- sostuvieron una reunión para abordar el complicado momento
que atraviesa el yacimiento, producto de la baja del cobre y el deterioro
de los mercados.
Por medio de un comunicado, el presidente y el vicepresidente del consejo de administración de KGHM indicaron que ambas compañías estuvieVSRHIEGYIVHSIRLEGIVXSHSWPSWIWJYIV^SWTEVEWYTIVEVPEWHM½GYPXEHIW
por lo que analizaron una serie de medidas que apuntan a hacer más
I½GMIRXIPESTIVEGMzRHIP]EGMQMIRXSYFMGEHSIRPE6IKMzRHI%RXSJEKEWXE
Los ejecutivos de la empresa polaca agregaron que superar los retos actuales es la base para tomar nuevas decisiones estratégicas relacionadas
con Sierra Gorda, uno de los últimos grandes proyectos mineros de cobre
en entrar en operación, por lo que pretenden mantener la relación estratégica con Sumitomo.
nme 24 marzo
BREVES MIN 24-28.indd 24
07-03-16 17:51
Molibdeno baja su aporte al Fisco de 8% a 0,9% en una década
(IEGYIVHSEHEXSWIPEFSVEHSWTSVPE(MVIGGMzR+IRIVEPHI4VIWYTYIWXSW(MTVIWIRXVIIP]IPIPQSPMFHIRSFENz
HVjWXMGEQIRXIWYETSVXIEPEWEVGEW½WGEPIWTSVGSRGITXSHIZIRXE
(IIWXEQERIVEWMIRPSWMRKVIWSWTSVIWXIQIXEPVITVIWIRXEVSRGIVGEHIPHIPSWMRKVIWSWHIP*MWGSGYERHS'SHIPGSETSVXz
GIVGEHI97QMPPSRIWIRI\GIHIRXIWWzPSTSVQSPMFHIRSYREHqGEHEQjWXEVHIIRPSWMRKVIWSWTSVZIRXEHIQSPMFHIRS
se situaron en torno a 0,9% de los ingresos, con excedentes por este concepto por parte de la estatal cercanos a US$ 200 millones.
7MRIQFEVKSHIWHIPE(MTVIWE½VQERUYIPETVSHYGGMzRHIQSPMFHIRSHIPEGYTVuJIVEIWXEXEPUYIIRPPIKzEXSRIPEHEW
QqXVMGEW81 GSRXVMFY]IEVIHYGMVPSWGSWXSWHIPEI\TPSXEGMzRHIGSFVI 7MFMIRIPEySTEWEHSWIVIHYNIVSRIRPSWGSWXSW
totales de la estatal, también existieron otros períodos en que llegaron a rebajar en 40% este ítem, recalca el informe.
Nuevo plan de
Anglo American
potenciará Collahuasi
y Los Bronces
Luego de que a mediados de febrero
Anglo American diera a conocer las millonarias pérdidas que tuvo en 2015, la
compañía trabaja en una nueva estrategia para revertir los malos resultados
durante ese año.
Para frenar la tendencia, Anglo American se enfocará en tres líneas de negocios: diamantes, platino y cobre, por lo
UYIHI½RMzYRE±GEVXIVETVMRGMTEP²UYI
considera 16 activos prioritarios. Entre
qWXSWPEGSQTEyuEHIWXEGzUYIGSRGIRXVEVjWYWRIKSGMSW±IRXSVRSEWYWMRXIreses en dos de las minas de cobre más
grandes del mundo: Los Bronces, incluiHEPEJYRHMGMzR'LEKVIW]'SPPELYEWMIR
PEJSXS²
±2YIWXVE GEVXIVE TVMRGMTEP GVIE YR RIgocio altamente atractivo, competitivo y
bien equilibrado, con la ventaja del tamaño, conocimiento técnico y recursos
minerales, lo cual ofrece un potencial de
crecimiento importante en el largo pla^S² WSWXYZS 1EVO 'YXMJERM TVIWMHIRXI
Ejecutivo de la compañía.
'EFIVIGSVHEVUYI%RKPSVIKMWXVzTqVdidas por US$ 5.624 millones durante
el año pasado, una cifra que más que
HYTPMGz PE GEuHE HI 97 millones).
marzo 25 nme
BREVES MIN 24-28.indd 25
07-03-16 17:51
Sonami proyecta cierre de faenas de 200
pequeños mineros por precio del cobre
(YVERXIIPYRSWTIUYIySWTVSHYGXSVIWQMRIVSWTSHVuERGIVVEVWYWJEIREWHIFMHSEPSWFENSWTVIGMSWHIPGSFVIIRPSWQIVGEHSWMRXIVREGMSREPIW%WuPSE½VQzIPZMGITVIWMHIRXIHIPE7SREQM4EXVMGMS'qWTIHIWIRPEJSXSUYMIREVKYQIRXzUYIWIKRGMJVEWHI
)REQMPSWTIUYIySWQMRIVSWFENEVSRHIEIRXVI½RIWHI]½RIWHI
±0ETIUYIyEQMRIVuEXMIRIIRXVI]TYIWXSWHIXVEFENSHMVIGXSWMRGSRXEVGSR
PSWMRHMVIGXSW]WIVZMGMSWERI\SWGSQSIPXVERWTSVXI²E½VQz'qWTIHIWUYMIREKVIKzUYI
IPLIGLS±RSIWQIRSV]GVIIQSWUYIWMIPTVIGMSHIPGSFVIWMKYIFENERHSZEQSWETIVHIV
HIEUYuE½RHIEySSXVEWJEIREW²EHZMVXMz
(MGLEHMWQMRYGMzR±WYTSRIPETqVHMHEHIIRXVI]TYIWXSWHIXVEFENS²WIyEPz
IPZMGITVIWMHIRXIHIPE7SREQMEPWYFVE]EVUYI±IWXEQSWLEFPERHSHIGEWMYRHIPXSXEP
HIXVEFENEHSVIWHIPWIGXSV²
'EFIHIWXEGEVUYIHIEGYIVHSEHEXSWHI)REQMPSWGSWXSWHITVSHYGGMzRHIPSWTIUYIySWQMRIVSW½KYVERIRXVI]HzPEVIWTSVPMFVETVSQIHMS
Barrick invertiría US$ 2.200 millones en
“Alturas”, su nuevo yacimiento en Chile
%½RIWHIPQIWTEWEHS&EVVMGOHMSEGSRSGIVWYGEVXIVEHITVS]IGXSWHIPEVKSTPE^SHSRHIHIWXEGE±%PXYVEW²IPRYIZS
HIWGYFVMQMIRXSVIEPM^EHSTSVPEGSQTEyuEIRPE6IKMzRHI'SUYMQFSUYIGSRXEVuEGSRVIGYVWSWMRMGMEPIWHIQMPPSRIW
HISR^EWHISVS
)PTVS]IGXSHIEGYIVHSEMRJSVQEGMzRHEHEEGSRSGIVTSVPEGSQTEyuEXIRHVuEYREMRZIVWMzRHI97QMPPSRIW
QSRXSUYITSWMGMSREEPEMRMGMEXMZEGSQSIPJYXYVS]EGMQMIRXSGSRQE]SVMRZIVWMzRTVIZMWXEHIPEIQTVIWE
7IKRIPGVSRSKVEQETVIWIRXEHSIR2YIZE=SVOPEGSRWXVYGGMzRHIPEQMRETSHVuEMRMGMEVWIIRIPEySWMIQTVI]
GYERHSPSKVISFXIRIVXSHSWPSWTIVQMWSWRIGIWEVMSW'YEXVSEySWQjWXEVHIIPWITSHVuEMRMGMEVPETVSHYGGMzRHI
IWXI]EGMQMIRXSYFMGEHSIRPEWGIVGERuEWHIPEI\QMRE)P-RHMS
%½RIWHIIRIVSPEGEQTEyEHII\TPSVEGMzRHI%PXYVEWVIGMFMzPEETVSFEGMzREQFMIRXEPHSRHIWIHIWXMREVjR97QMPPSRIW'SRIPTIVQMWS&EVVMGOEQTPMEVjIPTVSKVEQEHIWSRHENIWHIWHIETPEXEJSVQEWTEVEEWuTSHIVHIXIVQMREV
PEWGEVEGXIVuWXMGEWHIPHITzWMXSHIQMRIVEP
Sector minero lidera aumento
de solicitudes de seguros de cesantía en 2015
(I EGYIVHS E HEXSW HIP -RWXMXYXS 2EGMSREP HI )WXEHuWXMGEW
-2) HYVERXI IP EyS TEWEHS MRKVIWEVSR WSPMGMXYHIWETVSFEHEWTEVEEGGIHIVEPWIKYVSHIGIWERXuEPSUYI
WMKRM½GzYREFENEHIVIWTIGXSHIPXSXEPHIPEySERXIVMSV
GYERHSWIKIWXEVSRVIUYIVMQMIRXSW
2S SFWXERXI HIWHI IP SVKERMWQS HIWXEGEVSR UYI IP WIGXSV
IGSRzQMGSIRIPUYIQjWEYQIRXEVSRPEWWSPMGMXYHIWHIWIKYVS
HIGIWERXuEJYIPEQMRIVuEUYITEWzHIVIUYIVMQMIRXSWE
IRXVI]PSUYIVITVIWIRXEYREP^EHI
ERYEP
)PHMVIGXSVHIP'IRXVSHI)RGYIWXEW])WXYHMSW0SRKMXYHMREPIW
9'(EZMH&VEZSI\TPMGzUYIIRIPGEWSHIPEQMRIVuEPEWWSPMGMXYHIWHIIWXIFIRI½GMSEYQIRXEVSRIRGEWMQMIRXVEWUYI
PESGYTEGMzRVIKMWXVzYREGEuHEERYEPHI
'EFIHIWXEGEVUYI%RXSJEKEWXEPMHIVEIPEYQIRXSHITIXMGMSRIWGSRYRGVIGMQMIRXSHIEPTEWEVHIWSPMGMXYHIW
EPSUYIWIEWSGMEEPEQIRSVSGYTEGMzRIRQMRIVuE
nme 26 marzo
BREVES MIN 24-28.indd 26
07-03-16 17:51
Alza del cobre en febrero logra
recuperar casi todo lo perdido
durante 2016
Luego de una serie de retrocesos en el
precio del cobre que hicieron caer la
cotización incluso por debajo de los
dos dólares la libra a inicios de año,
E½RIWHIJIFVIVSIPQIXEPGSQIRzó a repuntar hasta alcanzar su
QE]SVZEPSVIRPSUYIZEHI
PEPMFVEIPHIJIFVIVS
(IIWXEQERIVEIPQIXEPVSNSVIGYpera el terreno perdido durante estos
HSW TVMQIVSW QIWIW HIP EyS EP MKYEPEV IP
TVIGMSGSRIPUYIXIVQMRz97PEPMFVE7MRIQFEVKS ] TIWI E PEW RYIZEW EP^EW UYI LE ERSXEHS IP GSFVI
HYVERXIPSWTVMQIVSWHuEWHIQEV^SERIWXjPINSWHIPTVSQIHMSERYEPUYIWIVIKMWXVzIPEySTEWEHS97
55.000 trabajadores directos
han sido despedidos en el
sector minero desde 2012
'YERHS IR PE MRHYWXVME QMRIVE EPGER^z IP TIEO
HISGYTEGMzRHMVIGXELEWXEHMGMIQFVIHIPEySTEWEHS
PE QMRIVuE TVIWGMRHMz HI XVEFENEHSVIW HMVIGXSW
TEWERHSHITIVWSREWEIRIPTIVuSHS WIKR HEXSW HIP -RWXMXYXS 2EGMSREP HI )WXEHuWXMGEW
-2)IRXVIKEHSWTSVPE7SGMIHEH2EGMSREPHI1MRIVuE
7SREQM
)WXEIWYREQYIWXVEHIPSWGYVSTERSVEQEUYILEIWXEHSZMZMIRHSPEQMRIVuEIRPSWPXMQSWEySWHSRHIIP
ENYWXIQjWJYIVXIWIHMSNYWXEQIRXIIPEySTEWEHSWSPS
GSRWMHIVERHS PE ZEVMEGMzR IRXVI HMGMIQFVI HI ]
IP QMWQS QIW HI WI VIHYNIVSR TYIWXSW
HIXVEFENS
= IW UYI TSV GEHE XVEFENEHSV HMVIGXS UYI LE] IR PE
QMRIVuEWIKIRIVERIQTPISWMRHMVIGXSWWIKRHEXSWHIP'SRWINS1MRIVS4SVPSXERXSWMIRXVISGXYFVI
HI]HMGMIQFVIHIWIHIWZMRGYPzE
XVEFENEHSVIWIRPETVjGXMGEWILERVIQSZMHSEPVIHIHSV
HIXVEFENEHSVIWMRHMVIGXSWGMJVEUYIRSHINEHI
WIVGSRWMHIVEFPI
¡'zQSWITVS]IGXEIWXIIWGIREVMSTEVEIPEySIRGYVWS#4EVE.SEUYuR:MPPEVMRSTVIWMHIRXIINIGYXMZSHIP'SRWINS1MRIVSIWGSQTPINSZEXMGMREVPSUYITEWEVjHEHS
IPGSQTSVXEQMIRXSZSPjXMPHIPTVIGMSHIPGSFVITIVSE
WYNYMGMS±IPIQTPISIRQMRIVuEHIFMIVEXIRHIVEIWXEFMPM^EVWI²E½VQE
marzo 27 nme
BREVES MIN 24-28.indd 27
08-03-16 16:38
SEA aprueba proyecto
“Explotación Recursos Norte” de División El Teniente
El Servicio de Evaluación Ambiental (SEA) de la región de O’Higgins aprobó de forma unánime el proyecto “Explotación
Recursos Norte” de Codelco, iniciativa perteneciente a la División El Teniente de Codelco, que tiene como propósito dar
GSRXMRYMHEHSTIVEXMZEEPEWEGXYEPIWMRWXEPEGMSRIWHITVSGIWEQMIRXSHIQMRIVEPEHIQjWHIHEV¾I\MFMPMHEHEPTVSKVEQEHI
producción de la actual mina subterránea.
“El proyecto tiene por objeto la explotación subterránea y chancado de
154 millones de toneladas de mineral presentes en el cuerpo mineralizado
YFMGEHSIRPEREGMIRXIHIPE5YIFVEHE8IRMIRXIHI½RMIRHSIPWMWXIQEHI
manejo de materiales que permita enviar mineral hacia las plantas de Sewell
y/o de Colón, sin aumentar su actual nivel de procesamiento de mineral”,
indicó Codelco.
De esta manera, el proyecto que tendrá un costo de US$485 millones, no
WMKRM½GEVjYREYQIRXSIRPEWXEWEWHITVSHYGGMzRHIPE(MZMWMzR)P8IRMIRXI
sino que reemplazará la explotación de otros sectores ya agotados del yacimiento, manteniendo así las plantas Sewell y Colón activas.
Codelco profundizará
ajuste de costos durante
este año
En 2015 Codelco logró una reducción
promedio de 7,8% de su cash cost o
costo de caja, gracias a un duro reajuste
que incluyó bajar su Capex en US$1.000
millones. Una estrategia que le rindió frutos a la cuprífera estatal y que este año
espera profundizar. Así lo planteó el presidente del directorio de la corporación,
Óscar Landerretche, en el marco de la
25th Global Metals & Mining Conference, organizada por BMO Capital Markets
en Estados Unidos.
Concretamente, el objetivo de Codelco
es pasar de un costo de US$1,38 de
2015, a US$1,26 este año. El foco estará
puesto directamente en las operaciones,
apuntando a que todas las divisiones
operen con un costo de caja por debajo
de los US$2, asegurando que generen
excedentes.
La división donde se hará un trabajo más
intensivo será Salvador. Allí, la minera
apuesta a reducir su cash cost o costo C1
en 27%, pasando de los US$2,48 por libra
promedio de 2015 -largamente por sobre
los precios actuales del cobre, más cerca
de los US$2- a US$1,82 por libra.
Chile cae en encuesta Fraser como una
de las mejores zonas del mundo para
inversión en minería
Según la encuesta realizada por el think tank canadiense Fraser, Chile
cayó dos puestos respecto al año anterior en el índice de atractivo de
inversión, aunque lidera por lejos en América Latina.
De acuerdo al informe realizado en base a encuestas a ejecutivos de
empresas de exploración y correspondiente a 2015, Chile se ubicó en el
lugar once dentro de 109 distritos. En 2014 el país ocupaba el noveno
lugar dentro de 122 jurisdicciones.
La mejor ubicación de Chile data del 2013, cuando se ubicó en el cuarto
lugar entre 112 distritos.
A nivel mundial, Australia, Canadá y Estados Unidos concentran las mejores zonas para la inversión en este sector. Más abajo aparecen Colombia
(55), Brasil (56), Nicaragua (65), Salta en Argentina (71), Panamá (74) y
San Juan en Argentina (75). República Dominicana (81) cierra el listado de
los distritos más relevantes en América Latina.
El índice de atractivo de inversión combina la percepción sobre las políticas públicas, con un peso del 40%, y los recursos mineros del distrito,
con 60% de relevancia.
nme 28 marzo
BREVES MIN 24-28.indd 28
07-03-16 17:52
Avisos.indd 1
07-03-16 14:56
Foto: Felipe Pinto
Joseph Ramos, presidente de la
Comisión de Productividad:
“Tenemos una
oportunidad
para hacer las
cosas mejor”
Creada en julio pasado, la Comisión Nacional de Productividad ya suma
ocho meses de funcionamiento y un claro horizonte de trabajo para este año
que tiene metas y plazos. Elevar la productividad de la minería será tarea
prioritaria de esta instancia encabezada por Joseph Ramos. En entrevista
con Revista Nueva Minería y Energía, el economista explica el trabajo que
realiza la comisión para intentar acercar la industria local a los niveles de
productividad minera que exhiben los países líderes del mundo.
Joaquín Ruiz
E
l diagnóstico es claro: la productividad en el país no sólo se
ha estancado, sino que incluso ha bajado en áreas tan sensibles
para la economía nacional como la minería. Por lo tanto, si se
quiere elevar la productividad del país en su conjunto, por qué
no comenzar por una de sus industrias más emblemáticas.
Con este mandato comenzó a trabajar la Comisión Nacional
de Productividad (CNP), formada en julio pasado luego que la
4VIWMHIRXE&EGLIPIXS½GMEPM^EVEIPRSQFVEQMIRXSHIWYWSGLS
miembros, encabezados por el destacado ingeniero y economista de la Universidad de Chile, Joseph Ramos.
La tarea, sin duda, no es fácil. En Australia, modelo paradigmático en cuanto a productividad, trabajan más de 200 personas
en una instancia parecida a la que se creó en Chile. Un número que contrasta con los ocho comisionados y el acotado
presupuesto que tiene la CNP. Por ahora hay entusiasmo y un
horizonte de trabajo que tiene metas y plazos. Pero ¿será su½GMIRXI#±)WXEQSWIQTI^ERHS,EKEQSWPETIKEFMIRHMKS]S
y después (la comisión) crecerá al tamaño que deba crecer”,
dice Joseph Ramos, en entrevista con Revista Nueva Minería
y Energía.
nme 30 marzo
ENTRE JOSEPH 30-34.indd 30
09-03-16 14:00
Entonces, ¿la idea es que esta comisión se
transforme en una instancia permanente
sobre productividad?
Sí. Esto no es como la llamada “Comisión Bravo” o la “Comisión Engel”, que
tenían un rango determinado de tiempo. Esto pretende ser una agencia permanente de gobierno, que surge de un
decreto presidencial, aunque no es ley
todavía. Pienso que en la medida que
la comisión se muestre provechosa, y
creo que lo va a demostrar, se puede
hacer una ley que establezca la creación
de una comisión nacional, o una agencia,
o como se llame, y así formalizarla. En
estos momentos está formalizado por
los tres años desde que la Presidenta
Bachelet lo anunció, y terminaría todo
esto en julio del año 2018, cuando ella
ya no sea Presidenta. Y ahí terminaría, si
es que no se renueva. Pero la intención
de todos con los que he conversado, es
que la comisión siga. Entonces no veo
que estemos en peligro de extinción.
+IRIVEPQIRXI WI GEPM½GE E PE QMRIVuE
como una industria de “clase mundial”, al
menos así lo destaca la propia industria.
Sin embargo, en aspectos de productividad, la minería chilena está lejos de tener
índices de clase mundial. ¿Qué impresión
se ha formado?
Si bien dentro de Chile la minería es
uno de los sectores de más alta productividad relativa, también lo es en
otros países mineros, de tal modo que
la brecha que he visto con países como
Australia, que tiene altas prácticas internacionales, todavía nos separa como un
tercio. Es decir, podríamos subir todavía
un 30% más, si trabajáramos con la productividad australiana. Y creemos que el
tema no se explica tanto por los equi-
pos, porque muchas de las empresas
hasta son las mismas. Sin embargo, con
tecnología parecida, el aprovechamiento
que se hace es inadecuado. Uno de los
índices (que se utiliza para medir esto)
WIVI½IVIEPEWLSVEWUYIIPXVEFENEHSV
efectivamente está trabajando con algún
equipo, lo que se llama “tool in hand”.
Obviamente el empleador quisiera que
si le paga por trabajar 8 horas al día, estuviera efectivamente esas 8 horas con
“tool in hand”. Pero nadie es así. La gente tiene que comer, tiene que trasladarse de un lugar a otro, etc. Hay estudios
que he visto que dicen que en Chile el
trabajador trabaja efectivamente el 50%
de ese tiempo. Es decir, si trabaja 12 x
12, está 6 horas de verdad produciendo algo que crea valor. Y en los mejores
países, esa relación es 2/3. No es que se
trate de ir de 50% a 100%, porque solo
Dios lo hace. Pero sí podemos ir de 50%
a 2/3. Uno también se podría preguntar
lo mismo respecto a los equipos. Entonces si logramos que esos equipos estén
operando al máximo de las 24 horas del
día, también mejora mucho la productividad.
Entonces, ¿cómo se enfrentan esas brechas?
Mucha gente asocia esto incorrectaQIRXIEUYIIPXVEFENEHSVIW¾SNSSUYI
saca la vuelta, como se dice. Obviamente habrá algo de eso, pero yo pienso
que muchos de los temas de productividad tienen que ver con cómo uno
organiza la producción. Te puedo dar un
Foto: Codelco
En muchos foros se ha dicho que Chile
se encuentra atrasado en materia de productividad, respecto a lo que ocurre en
otros países como los que forman parte
de la OCDE. ¿Es tan así?
Sin ninguna duda. Esto no es una ciencia
abstrusa. Si Chile está a mitad de camino de desarrollo económico en PIB per
cápita, con US$ 23.000, en comparación
a los países europeos, por ejemplo, que
están arriba de US$ 40.000, una de las
razones para explicar esto es que aún
tenemos una brecha de productividad,
considerando el capital, el personal, y
los equipos que tenemos. Se estima que
hay una brecha de productividad del orden de 2/3 por debajo. Hay incluso algunos que hablan de la mitad. Esto tiene
que ver con las diferentes formas que
se mida. Si medimos sólo producto por
trabajador, estamos a menos de la mitad. Pero esto no necesariamente signi½GEUYIIPTEuWWIEMRI½GMIRXIWMRSUYI
puede tener que ver con que estamos
cavando un hoyo con una pala y el otro
lo está haciendo con una grúa. Entonces
obviamente es más productivo el que
lo hace con una grúa, pero no porque
qP WIE QjW TVSHYGXMZS S QjW I½GMIRXI
necesariamente.
Si bien dentro de Chile la minería es uno
de los sectores de más alta productividad
relativa, también lo es en otros países
mineros, explica Ramos. Por lo tanto,
todavía hay una brecha considerable que
separa a la minería chilena de lo que exhiben otros países mineros como Australia.
marzo 31 nme
ENTRE JOSEPH 30-34.indd 31
09-03-16 14:00
Avisos.indd 1
07-03-16 14:58
¿Qué aspectos se pueden gestionar o
coordinar de mejor manera en una faena?
Por ejemplo, en casos como los turnos
de trabajo que hay en la minería. Si se
trabaja 7 x7, y todos lo hacen de lunes
a domingo, por ejemplo, todos bajan de
la mina el domingo. Quiere decir que las
empresas de transporte necesitan buses
para el domingo. Pero el lunes ya no. Entonces, lo ideal sería una coordinación de
los turnos de tal modo que los buses que
trasladan a los trabajadores de una empresa los domingos, trasladen a los trabajadores de otra mina el lunes, y a otra
el martes, y a la otra el miércoles, y así
sucesivamente, con lo cual necesitarías
muchos menos buses para transportar a
PEKIRXI=EWuWIVuEQYGLSQjWI½GMIRXI
Pero ése sería un tema de coordinación
entre empresas. También me han dicho
muchos contratistas que al parecer, la
exigencia para entrar a una mina varía,
según la mina. Por lo tanto tienen que
hacer otra vez los trámites, los exámenes requeridos, para entrar a otra mina.
4EVEPEQMREIRWuIWXSRSIWMRI½GMIRXI
4IVSPEMRI½GMIRGMEIWTEVEPSWUYIIWXS]
contratando desde afuera. Y si los conXVEXMWXEWWSRMRI½GMIRXIWTSVUYIRSPSKVq
homologar criterios, entonces hay un
problema de homologación.
¿Cree que la minería tardó más de la cuenta en darse cuenta de estos temas para
enfrentarlos? Porque estos problemas se
podrían haber abordado mucho antes…
¿Por qué nadie se preocupaba de esto
antes? Bueno, porque los precios estaban altos, y (el objetivo) era “echarle
Foto: Felipe Pinto
ejemplo: en una obra de la construcción,
si uno ha programado mal la obra y los
materiales no llegan a tiempo cuando
empieza la próxima faena, entonces ese
equipo de trabajadores no tiene algo
útil que hacer. Porque si no llegan los
materiales, lo que vinieron a hacer, no lo
van a poder hacer.Y eso es un problema
HITPERM½GEGMzR)RXSRGIWQYGLEWZIGIW
los problemas en la minería son de esa
índole. Digo esto para que no se crea
que el tema es que los trabajadores son
¾SNSWSUYIWEGERPEZYIPXE
para adelante”. Ahora están mirando todos estos aspectos. Todo esto es lo que
vamos a abordar en nuestro trabajo.
¿En qué consistirá el trabajo?
Vamos a comparar a alrededor de 8 faenas mineras diferentes con las mejores
prácticas que hay en Australia, Estados
Unidos, Canadá y Perú, en temas como
la productividad de la mano de obra, la
productividad de los equipos, etc. Una vez
LIGLE IWE GSQTEVEGMzR MHIRXM½GEVIQSW
brechas de productividad. En una faena,
por ejemplo, podríamos detectar una brecha de 30%, en otra 50%, en otra 20%. Y
luego vienen las preguntas: qué parte de
esa brecha se debe a las regulaciones de
políticas públicas y qué cosas se tendrían
que hacer para corregirlas; qué parte
de esa brecha se deben a problemas de
coordinación entre la industria; y qué parte de la brecha son cosas esencialmente
de la gestión misma de la empresa.
“La productividad minera ha caído en los
últimos 15 años. La mitad de esa caída se
debe a un deterioro en la ley del mineral
(…) pero aún ajustando por este factor,
estudios de Cochilco indican que hay una
caída no despreciable de 20 a 25% en los
últimos 15 años. Y eso sí es reversible”,
asegura Ramos.
Cuando el gobierno anunció la creación
de la CNP, se explicó que la productividad
minera sería el primer objeto de estudio y
análisis por parte de la comisión. ¿Por qué
se decidió priorizar a la minería?
A nivel nacional, la productividad ha estado plana en los últimos 15 años. No
es que el país no ha crecido; ha crecido
sobre la base de tener más equipos, y
más capital humano. Pero no por hacerlo mejor. Y uno quisiera trabajar los
marzo 33 nme
ENTRE JOSEPH 30-34.indd 33
09-03-16 14:01
Las empresas hablan ahora de que todo
esto representa una oportunidad…
Tenemos una oportunidad para hacer
las cosas mejor.
¿Ha sido difícil convocar a los diferentes
actores involucrados para trabajar en estos temas?
Nos costó mucho armar esto. No es fácil.
Uno tenía que poner de acuerdo a diferentes actores como Consejo Minero,
Cochilco, Fundación Chile, entre otros, y
PYIKSMHIRXM½GEVQY]HIXEPPEHEQIRXIUYq
es lo que exactamente queremos. Se han
hecho estudios, pero queremos ir más allá,
queremos esta comparación internacional
con varios países. Todo esto fue un proceso que tomó desde septiembre hasta
enero para armar convenios con todos
los actores, para que esto anduviera.Y eso
salió con una toma de razón de ContraloVuEE½RHIEySEWuUYIIPTVS]IGXSIQTIzó desde enero a realizarse.
¿Tiene algún plazo para realizar este programa?
Sí, hay un plazo. Probablemente en
julio habrá un primer borrador. Antes
Foto: Zublin
tres motores: mejores equipos, es decir
inversión; mejor capital humano, es decir, inversión en capital humano; y productividad. Y eso fue lo que pasó en
los años ’90. Los tres motores andaban.
Ahora, en cambio, sólo andan dos de los
tres. Eso en el caso de la productividad
general. En el caso de la productividad
minera, ésta ha caído en los últimos 15
años. Pero la mitad de esa caída se debe
a un deterioro en la ley del mineral, y
IWSWIQERM½IWXEGSQSTqVHMHEHITVSductividad. Eso no es porque estemos
WMIRHSQjWMRI½GMIRXIWWSRGSRHMGMSRIW
geológicas naturales. Es decir, tienes que
machucar el doble de roca para extraer
el cobre, porque la ley es la mitad. Pero
aún ajustando por este factor (pérdida
de ley), estudios de Cochilco indican
que hay una caída no despreciable de
20 a 25% en los últimos 15 años. Y eso
sí es reversible. Este es un país de vocación minera, entonces no podemos
darle la espalda a eso.
de eso, en marzo, probablemente haremos circular un “issue paper”, como
PSPPEQERPSWEYWXVEPMERSWUYIWIVI½Ire a los temas bajo estudio. Es decir,
en unas 15 a 20 páginas contar lo que
se está haciendo, las preguntas que se
quieren responder, y eso para informar a la comunidad, e invitar a algunos
que no conocemos. Porque así como
existen entidades que han hecho trabajos que conocemos, haya otros que
pudieran llegarnos en este período.
Entonces en julio tendremos un primer borrador sobre la base de todos
estos estudios, después ese borrador
circula para tentativas recomendaciones, donde ahí sí empezamos a pisar
callos. En ese período invitamos a los
interesados a comentar estos estudios
y recomendaciones. Ese proceso podría durar al menos unos dos meses.
Y en octubre, o tal vez en noviembre,
XIRHVIQSWIPMRJSVQI½REPGSRRYIWtras recomendaciones.
“Mucha gente asocia esto (la baja
productividad) incorrectamente a que
HOWUDEDMDGRUHVÁRMRRTXHVDFDOD
vuelta, como se dice. Obviamente habrá
algo de eso, pero yo pienso que muchos de
los temas de productividad tienen que
ver con cómo uno organiza la
producción”, dice Joseph Ramos.
¿Está obligado el gobierno a tomar estas
recomendaciones?
Frente a trabajos mandatados por el
gobierno, el Ejecutivo se autoimpuso
la obligación de explicar porque no
acepta las recomendaciones que decide no aceptar. Puede decir, no es
factible, no está la plata, no estamos
de acuerdo, pero tiene que dar una
explicación.
nme 34 marzo
ENTRE JOSEPH 30-34.indd 34
09-03-16 14:03
Avisos.indd 1
07-03-16 14:58
Foto: María Sabiala
Minería en México
Testigo del vaivén
de las inversiones
Posicionado como un país minero, México ha sido testigo del escenario
de incertidumbre que ha debido sortear este rubro en los últimos años.
Una realidad que repercute en las proyecciones que los actores del sector
mantienen para la industria en esta nación latinoamericana.
Camila Morales
A
inicios de febrero la Comisión Chilena del Cobre (Cochilco) dio a conocer un estudio sobre la exploración minera
durante el 2015. En el informe, destaca que por sobre Chile
-que ascendió del quinto lugar en 2014 a la cuarta posición en
½KYVER EPKYRSW HIWXMRSW XVEHMGMSREPIW HI I\TPSVEGMzR
como Estados Unidos (3), Australia (2) y Canadá (1).
¿Qué pasó con otros países de Latinoamérica que destacan
por su potencial minero? Una nación que llamó la atención
por la baja en las posiciones fue México, al descender cuatro
puestos.
“Cabe resaltar la fuerte caída de México, que pasa del cuarto lugar
en 2014 a la octava posición en 2015, con un 5,7% de participación
en exploración”, señala el documento emitido por Cochilco.
Para quienes forman parte de la industria minera en ese país,
PE FENE IR IP VEROMRK IW VI¾INS HI PS UYI LE WYGIHMHS GSR
México en el último tiempo. Nuevos impuestos derivados de
la Reforma Fiscal que impulsa el presidente Enrique Peña Nieto, sumado a la baja en los precios de los commodities a nivel
QYRHMEPQERXMIRIRE1q\MGSGSQSYR½IPXIWXMKSHIPZEMZqR
de las inversiones.
La mina Buenavista del Cobre, ubicada
en Sonora, en plena operación.
nme
nm
n
me
m
e3
366 m
ma
marzo
arz
rrzo
zo
z
o
VISION MEX 36-38.indd 36
07-03-16 17:42
Foto: Fresnillo plc
Aunque la Cámara Minera de México
proyectaba inversiones en el rubro por US$
PLOORQHVHQÀQDOPHQWHHVWHSDtV
atrajo capitales por US$ 4.500 millones.
Mientras a inicios del año pasado la
Cámara Minera de México (Camimex)
proyectaba inversiones para el rubro
TSV97QMPPSRIWIR½REPmente esta nación sólo atrajo capitales
por US$ 4.500 millones, lo que equivale a una caída interanual de 9,1%, de
acuerdo a datos de la Secretaría de Economía de ese país.
El monto representa la tercera caída anual de este indicador, desde el
máximo histórico alcanzado en el año
2012, cuando sumó US$ 8.043 millones. Por esta razón, quienes forman
par te del rubro en ese país buscan
aunar esfuerzos para romper con el
escenario a la baja.
En medio de las intenciones por revertir esta tendencia, el 2016 aparece
GSQSYREySHIMR¾I\MzR3EPQIRSW
así lo cree la Secretaría de Economía de
México, que proyecta US$ 5.000 millones en inversiones mineras para este
año, gracias a capitales foráneos atraídos
principalmente por minas de oro.
Más impuestos y baja de precios
De los 803 proyectos mineros que
México tenía en carpeta durante el
MRMGMEXMZEW WYWTIRHMIVSR S½cialmente sus planes de negocios. Además de la baja sostenida en el precio de
los commodities, esta postergación develó la coyuntura que vive el país luego
del cambio en las reglas tributarias por
parte del gobierno.
En 2014, ante la necesidad de recaudar
fondos para fortalecer el gasto público,
los congresistas consideraron oportuno crear nuevas cargas impositivas para
el rubro minero. A dos años de este
hecho, la discusión sobre el impacto
real que han tenido estas medidas se
mantiene.
El impuesto del 7,5% en minas zinc, ploQS½IVVS]IPHIKVEZEQIRTEVEPEW
minas que exploten oro, plata y platino,
repercutió en los planes de inversiones
desde aquel año hasta la fecha, según las
organizaciones gremiales del sector minero en México.
“La imposición de nuevos derechos
restó competitividad a la industria a
nivel internacional. Lamentablemente,
PSW GEQFMSW ½WGEPIW LER GSRZIVXMHS E
México en uno de los países más caros
para invertir y ha hecho que tengamos
un comportamiento negativo”, indica
Sergio Almazán, director General de la
Cámara Minera de México (Camimex).
Esta combinación de factores para la industria minera ha generado que si bien,
por una parte, las cifras de ingresos económicos para el gobierno se han visto
incrementadas, por otra, disminuyan los
planes de los inversionistas para explorar y explotar uno de los países con mayor potencial.
“Las empresas del sector requieren implementar una reestructura en su modelo de negocio operativo, así como
una revisión de sus estrategias de crecimiento a mediano plazo. A consecuencia de estos desafíos, seguramente
habrá proyectos de explotación que
sean suspendidos o abandonados totalmente”, indicaron desde la empresa de
auditoría KPMG México.
¿Qué dice el gobierno? En este tira y
E¾SNE IRXVI PIKMWPEHSVIW ] PEW IQTVIWEW
mineras presentes en este país, el Ejecutivo ha optado por mantener la calma
ante el descenso de las inversiones mineras, y destacar el destino que tiene el
dinero entregado por las compañías por
concepto de impuestos.
“Este acto de justicia social hace posible que los municipios más pobres
con actividades mineras cuenten con
proyectos en alumbrado, agua potable,
infraestructura, caminos, pavimentación,
modernización y ampliación de vialidades urbanas. Estas obras hoy son una
realidad gracias a la Reforma Fiscal impulsada por el Presidente de la República”, indicó la secretaria de Desarrollo
Agrario, Territorial y Urbano, Rosario
Robles Berlanga.
En relación a este Fondo Minero, la secretaria de gobierno informó que los
estados de Sonora, Zacatecas, Chihuahua, Durango, Coahuila y Michoacán
marzo 37 nme
VISION MEX 36-38.indd 37
07-03-16 17:42
Foto: Joaquín Ruiz
concentran el 75% de estos recursos.
Asimismo, recalcó que el dinero entregado a inicios de este año pertenece a
lo acontecido en 2014, y que los recursos del año pasado permitirán al país “a
pensar en grande”.
Buscando el repunte
A pesar de las repercusiones que ha
traído la Reforma Fiscal del gobierno en
medio de un escenario con los precios
de los metales a la baja, no hay dudas
de que la minería en México es crucial
para el desarrollo del país. De acuerdo
al Programa de Desarrollo Minero (Prodemin) 2013-2018, el rubro representa
la cuarta fuente generadora de divisas,
luego de la industria automotriz, eléctrica-electrónica y el petróleo.
Considerado un país líder en la producción de plata, además de estar posicionado entre los 10 principales productores de otros 19 minerales, y con el
70% del territorio nacional con potencial geológico; México continúa siendo
una nación referente en el rubro a nivel
mundial. Para el director Ejecutivo de la
Camimex, el 2016 puede ser un año clave para que la minería tome un nuevo
impulso en este país.
“En México el sector minero es uno de
los principales motores económicos, ya
que ofrece 352.000 empleos directos
Sergio Almazán, director General de la
Cámara Minera de México (Camimex).
Principales proyectos de oro en México (2015)
Proyecto
Empresa
Estado
Producción
anual (oz)
Torex Gold
Guerrero
128.000
US$ 725 millones
San Julián
Fresnillo
Chihuahua
44.000
US$ 516 millones
Santa Gertrudis
Gogold
Sonora
56.000
US$ 32 millones
Guadalupe
Coeur Mining
Chihuahua
s/i
US$ 10 millones
Julio/Santa Elena
Mexus Gold
Sonora
s/i
s/i
Morelos Norte
Inversión
Principales proyectos de plata en México (2015)
Proyecto
Empresa
San Julián
Fresnillo
Producción
anual (oz)
Inversión
Chihuahua
10.300
US$ 515 millones
La Encantada (expansión) First Majestic
Coahuila
4.500
s/i
La Tesorera (planta)
Zacatecas
s/i
s/i
Fuente: Camimex, reporte 2014
s/i: sin información
Arian Silver
Estado
y es una importante actividad económica generadora de divisas. Estamos
conscientes de que el mercado de los
minerales es cíclico, por lo que vendrán
mejores tiempos. En ese sentido, con½EQSW IR UYI PEW GSXM^EGMSRIW HI PSW
minerales muestren una recuperación
hacia la segunda mitad de 2016”, señala
Sergio Almazán.
Esta proyección condice con Prodemin,
el programa que impulsa el gobierno
hacia el 2018. Pues, además de promover mayores niveles de inversión y competitividad en el sector minero, procurar
IPEYQIRXSHI½RERGMEQMIRXSQSHIVRMzar la normatividad institucional para el
área y mejorar los procesos de atención
a trámites relacionados con las conceWMSRIWMRXIRXEVjHMZIVWM½GEVIPRIKSGMS
De acuerdo a lo estipulado en el Programa de Desarrollo Minero, el gobierno mexicano contempla expandir los
mercados para participar en la exploración y explotación de minerales que se
utilizan en la fabricación de productos
de alta tecnología, tales como titanio,
cobalto, antimonio y las tierras raras,
que son consideradas “el mineral del
futuro”.
“La industria minera es, sin lugar a dudas, una fuerte palanca de desarrollo
económico. Por esta razón, tenemos la
obligación de redoblar esfuerzos para
impulsarla. En 2014 contribuyó con el
HIP4-&]PSWFIRI½GMSWWSGMEPIWHI
la minería se extienden en 25 de los 32
estados del país. Por eso es importante
incentivar la ampliación del área, acorde
a la demanda mundial”, agrega el presidente de Camimex.
Es así como el propósito de abrir nuevas áreas en la industria minera es actualmente el objetivo primordial de los
actores que forman parte del sector en
México. No obstante, en medio de un
panorama de incertidumbre para el rubro a nivel mundial, y con la Reforma
Fiscal en pleno desarrollo, sólo queda
esperar la estrategia con que México
desarrollará la minería durante el 2016,
EyS HI½RMHS GSQS YR TYRXS HI MR¾I\MzRTSVIPKSFMIVRSIRGEFI^EHSTSV
Enrique Peña Nieto.
nme 38 marzo
VISION MEX 36-38.indd 38
07-03-16 17:42
Avisos.indd 1
07-03-16 14:59
La Ópera de Sídney es uno
de los monumentos más
famosos y distintivos del siglo XX.
Chile y Australia:
Consolidando sus
lazos comerciales
Australia es sinónimo de innovación y tecnología. Pero no sólo
eso. Los sectores minero y energético también se han posicionado
como fuentes clave de la economía australiana, dos rubros
productivos que lo unen con Chile y cuyas oportunidades de
negocios se proyectan auspiciosas entre ambos países.
Daniela Tapia
A
ustralia se ha convertido en un referente para el mundo
en diferentes aspectos. La calidad de vida es sólo uno de ellos.
De hecho, cuatro ciudades del país oceánico se encuentran
entre las diez mejores urbes del mundo para vivir, considerando factores como seguridad, salud, educación e infraestructura, según el estudio anual más reciente realizado por la revista
“The Economist”.
A esto se suma uno de sus baluartes más reconocidos: el alto
nivel de sus programas educativos que año a año atraen a
cientos de estudiantes de los rincones más diversos del planeta. No por nada, cuatro universidades de Australia se ubican
entre las cien mejores del mundo y 20 entre las 500 mejores.
En este campo, una de sus apuestas más vanguardistas ha
sido el for talecimiento de la educación técnica a través
nme 40 marzo
VISION AUST 40-43.indd 40
07-03-16 17:43
Los sectores minero y energético
se han posicionado como fuentes
clave de la economía australiana.
de un sistema conjunto que incluye
al gobierno, la industria y el sector de
la formación, todo respaldado por el
1EVGS %YWXVEPMERS HI 'YEPM½GEGMSRIW
%YWXVEPMER5YEPM½GEXMSRW*VEQI[SVO
que ar ticula el sistema educativo y
fomenta el aprendizaje a lo largo de
toda la vida.
Y es que a raíz de su interés por elevar
PEGEPMHEHIHYGEXMZEPEMR¾YIRGMEHI%YWtralia también se ha dejado sentir con
fuerza a través de sus políticas de investigación e innovación. Gracias a estas
medidas, cada día millones de personas
WSR FIRI½GMEHEW IR WY HMEVMS ZMZMV TSV
descubrimientos y avances tecnológicos provenientes precisamente, desde
el país oceánico. ¿Botones de muestra?
0EXIGRSPSKuETEVE;M*M+SSKPI1ETWPE
vacuna contra el virus del papiloma humano (que causa el 70% de los casos de
GjRGIVGIVZMGEPIPSuHSFMzRMGSIPYWS
de la penicilina como antibiótico, entre
muchos otros.
Para consolidar este liderazgo, en diciembre del 2015 el primer ministro,
Malcolm Turnbull, lanzó la “DeclaVEGMzR HI -RRSZEGMzR² GSR IP ½R HI
promover y potenciar la innovación
IR IP WIGXSV GMIRXu½GS HI%YWXVEPME E
través de la creación de fondos, incentivos tributarios, nuevos fondos de
½RERGMEQMIRXS TEVE MRZIWXMKEGMzR YRMversitaria y plataformas de aterrizaje
en el extranjero para emprendedores
australianos.
Pero no sólo su nivel de desarrollo ha
cautivado a millones de personas. TamFMqRPSLELIGLSPEHMZIVWM½GEGMzRHIWY
economía y la apertura de ésta, donde
América Latina, y en particular Chile, se
ha transformado en un enclave protagónico, luego que el país se convirtiera en
la primera nación latinoamericana con
UYI%YWXVEPME½VQzYR80'TEVETSXIRciar sus relaciones comerciales.
Las cifras y hechos avalan la relevancia de este tratado. Chile se convirtió
en el tercer socio comercial principal
de Australia en América Latina, con un
comercio bilateral en bienes y servicios
por más de 1.800 millones de dólares
australianos en 2013-2014 (equivalente
EYRSW97QMPPSRIW
A su vez, las exportaciones de bienes a
Chile superaron los US$ 350 millones
en dicho período, incluyendo carbón,
carne de vacuno y partes y equipos de
ingeniería civil. Los servicios exportados
a Chile, en tanto, alcanzaron los US$
186 millones, incluyendo viajes vinculados a educación y otros servicios profesionales y técnicos.
Mientras tanto, las importaciones australianas de productos chilenos superaron los US$1.065 millones en 20132014, incluyendo cobre, otros minerales
y concentrados, madera y frutas proce-
sadas y en conserva. Y las importaciones de servicios de Chile alcanzaron los
US$227 millones, principalmente en los
rubros del transporte y turismo.
Minería: un lazo en común
Tanto Chile como Australia comparten
una estructura productiva basada en
los recursos naturales como el vino, los
productos agrícolas y sobre todo, los
minerales.
En el caso de Australia, considerado
un país-continente de más de 7,7 miPPSRIWHIOMPzQIXVSWGYEHVEHSWGYIRta con un sector minero altamente
HMZIVWM½GEHSPuHIVQYRHMEPIRTVSHYGción de mineral de hierro, carbón y
gas, junto con otros minerales como
el oro, zinc, cobre, níquel y uranio, por
mencionar algunos.
Y más que eso. El país oceánico ha sabido transformarse en una potencia
minera, tanto en términos productivos
como tecnológicos. Aprovechando su
gran capacidad productiva y sus centros
de investigación de alto nivel, Australia
ha logrado desarrollar una pujante industria de equipos, tecnología y servicios para la minería, conocida como la
industria de las Mets (por su sigla en
MRKPqW
Así, este sector aporta alrededor del
6,5% del PIB de Australia, lo cual se
suma al 11,5% que aporta el sector de
marzo 41 nme
VISION AUST 40-43.indd 41
08-03-16 14:37
1
2
3
1: Australia, considerado un país-continente de más
de 7,7 millones de kilómetros cuadrados, es rico
en recursos naturales y en hermosos paisajes.
2: La Gran Barrera de Coral australiana es el mayor arrecife de
coral del mundo, concentrando una vasta diversidad biológica.
(O8OXʧXWDPELpQOODPDGR$\HUV5RXQDGHODV
mayores atracciones rocosas del Parque Nacional
Uluru-Kata Tjuta, ubicado al norte del país.
extracción y procesamiento. El volumen de ingresos
del sector Mets alcanza hoy los 90.000 millones de
dólares australianos anuales (unos US$ 63.989 millones), generando exportaciones de servicios por
27.000 millones de dólares australianos (US$ 19.196
millones).
“Muchas Mets de gran desarrollo tecnológico se
formaron en los últimos 30 años. A mediados de
los años ’80, la estrategia de aper tura y competitividad de Australia fue acompañada por iniciativas
de impulso a la innovación en sectores clave: agroindustria, biotecnología y, por supuesto, minería”,
explica Timothy Kane, embajador de Australia en
Chile.
De hecho, una de las ventajas competitivas de Australia
es la capacidad de desarrollar conocimientos y optimizar el proceso minero en su totalidad. En este sentido, el gobierno ha fomentado la colaboración entre
empresas, mundo académico y centros de excelencia
GSRIP½RHISTXMQM^EVPEGEHIREHIZEPSVHIPEQMRIVuE
HIWHIPEI\XVEGGMzRHIPVIGYVWSLEWXEIPTVSHYGXS½REP
generando valor agregado.
En esta línea, el año pasado el gobierno de Australia
lanzó la iniciativa Industry Growth Centres (Centros
de Crecimiento Industrial) en áreas en que el país
cuenta con ventajas comparativas y potencial de crecimiento, entre los que destaca el Centro de Crecimiento de Equipamiento, Tecnología y Servicios para
la Minería. Un lazo que lo une con Chile, país minero
por excelencia, donde resalta el establecimiento de
los Centros de Excelencia Internacional Csiro Chile y el Sustainable Minerals Institute (SMI-ICE) de la
University of Queensland, Australia, con el apoyo de
Corfo.
En este contexto, desde el año 2009 el SMI ha estado
trabajando con la Universidad de Concepción, para
ofrecer cursos de pregrado y postgrado con un foco
en sustentabilidad de la cadena productiva del cobre.
Csiro Chile, por su parte, aborda los principales desafíos que enfrenta la industria minera, impulsando el
mejoramiento de la cadena de valor y la integración
HIGETEGMHEHIWGMIRXu½GEWIRXVI'LMPI]%YWXVEPMEIR
vínculo con la Universidad de Chile, la Universidad
de Antofagasta, Cicitem y socios de la industria. Una
colaboración que incluye la investigación en georreGYVWSW TPERM½GEGMzR WMWXIQEW HI QMRIVuE MRXIPMKIRXI
procesamiento de minerales, gestión hídrica, energía
e impacto ambiental.
Energía, puntal de desarrollo
Si la minería se ha posicionado como una actividad
ancla de la economía australiana, también ha estado
a la vanguardia en la exploración y explotación de
nme 42 marzo
VISION AUST 40-43.indd 42
07-03-16 17:43
recursos energéticos, desde el carbón al petróleo,
pasando por el gas natural y otras fuentes fósiles no
convencionales.
Sin embargo, en las últimas décadas el país ha enfocado sus esfuerzos en aprovechar su envidiable
riqueza de energías renovables, desarrollando innovaciones en este pujante rubro.
=IWUYIKVEGMEWEWYKVERWYTIV½GMI%YWXVEPMERSLE
desaprovechado su potencial solar: uno de cada cinco hogares australianos hoy goza de energía solar, lo
que posiciona al país en los primeros lugares a nivel
mundial. Las estadísticas no sorprenden, ya que el país
cuenta con una larga trayectoria en innovación en
energía de este tipo.
Sus universidades son líderes en el desarrollo de céPYPEWJSXSZSPXEMGEWPSKVERHSPSWuRHMGIWHII½GMIRGME
QjW EPXSW HI PE MRHYWXVME%GXYEPQIRXI 'WMVS NYRXS
con algunas universidades se encuentra diseñando
células fotovoltaicas imprimibles, que permitirán
aprovechar la energía solar en cualquier tipo de suTIV½GMI
%WMQMWQS %YWXVEPME PMHIVE IP HIWEVVSPPS HI SXVEW
fuentes novedosas, tales como la energía mareomotriz, que ya está siendo comercializada dentro y
fuera del país oceánico.
=TEVEMRXIRWM½GEVERQjWWYMRXIVqWIRIPjQFMXS
HIPEWIRIVKuEWPMQTMEWIPKSFMIVRSHI%YWXVEPMEMRvierte activamente en el fomento de la innovación
IRIRIVKuEWVIRSZEFPIWEXVEZqWHIPE%KIRGME%YWXVEPMEREHI)RIVKuEW6IRSZEFPIW%VIRETSVWYWWMglas en inglés).
La institución cuenta con un fondo de alrededor de
2.000 millones de dólares australianos (US$ 1.422
millones) para invertir en proyectos e iniciativas que
catalicen la innovación y comercialización de enerKuEW VIRSZEFPIW GSR IP ½R HI HMZIVWM½GEV PE QEXVM^
energética del país.
)R TEVXMGYPEV %VIRE MRZMIVXI IR TVS]IGXSW UYI WI
encuentran en distinta etapa de ejecución, desde la
MRZIWXMKEGMzR]HIWEVVSPPSEPEGSQIVGMEPM^EGMzR'EHE
TVS]IGXS½RERGMEHSTSVIWXIGIRXVSMRGPY]IYRTPER
para difundir los conocimientos generados con el
VIWXSHIPEMRHYWXVME(IELuUYIPE½PSWSJuEHIGSQTEVXMVGSRSGMQMIRXSWLEQEVGEHSIPq\MXSHI%VIRE
GY]S TVIWMHIRXI +VIK &SYVRI ZMWMXz 'LMPI E ½RIW
del 2015.
¡'YjPIWWIVjRPSWTVz\MQSWTEWSWHIPEVIPEGMzRUYI
han construido ambos países? Todo parece indicar
que la tendencia es a seguir fortaleciendo esta alian^EFMPEXIVEPTYIWXERXS'LMPIGSQS%YWXVEPMEGSRXMnuarán desarrollando un fructífero intercambio comercial gracias a sectores tan relevantes para ambos
como la minería y la energía.
marzo 43 nme
VISION AUST 40-43.indd 43
07-03-16 17:43
Gobierno de Macri elimina
impuestos a exportaciones
mineras en Argentina
En el mes de febrero el presidente de Argentina, Mauricio
Macri, continuó su política de reducción de impuestos a las
grandes empresas exportadoras, al anunciar la eliminación
del gravamen que existía sobre el sector minero, por lo que
el país dejará de percibir cerca de US$ 220 millones en imTYIWXSWWIKRPE'jQEVE%VKIRXMREHI)QTVIWEW1MRIVEW
“Tenemos que crear infraestructura, tenemos que creer.
Los argentinos podemos, tenemos talento, hasta acá llegaron hijos de inmigrantes de todas partes del mundo, se instalaron en San Juan para crear la Argentina que soñamos”,
dijo Macri en una ceremonia realizada en la zona minera de
San Juan (en la foto).
Samarco llega a acuerdo con
gobierno de Brasil por tareas de
reparación de desastre ambiental
Luego de que en noviembre del año pasado colapsara la presa
de relaves de Minera Samarco -propiedad de Vale y BHP Billitoncon una escala de daño equivalente a 20.000 piscinas olímpicas
de residuos tóxicos, la empresa minera comenzó a trabajar en las
reparaciones por orden del gobierno local de Minas Gerais.
Tras varias reuniones sin éxito, en el mes de febrero Samarco
PPIKzEYREGYIVHSGSRIPKSFMIVRSPSGEP]PE½WGEPuETFPMGETEVE
GSRXVEXEVYREYHMXSVMRHITIRHMIRXIE½RHIUYIWYTIVZMWIPEW
tareas de reparación que realizará la compañía durante este año.
7IKRPSWXqVQMRSWHIIWXIEGYIVHS7EQEVGSHIFIVjIWXEFPIcer nuevas medidas de emergencia en el caso de otros posibles derrumbes de su red de depósitos de relaves. Asimismo,
la empresa deberá mantener un helicóptero preparado las 24
horas del día para equipos de rescate, sumado a la reparación
de los daños ocasionados por el desastre que dejó al menos
17 personas fallecidas.
Tras el anuncio, de inmediato las repercusiones no se hicieron esperar. La medida gubernamental recibió el respalHSHIPTVIWMHIRXIHIPE'jQEVEHI)\TSVXEHSVIW')6%
Enrique Mantilla, quien en un comunicado indicó que es
“indispensable para promover nuevas inversiones”.
Las empresas mineras presentes en Argentina exportan unas
70 variedades de metales, entre ellas oro, cobre y plata.
*RELHUQRSHUXDQRDÀUPDTXH
minería impulsará economía
en los próximos dos años
El ministro de Economía y FiRER^EWHI4IV1)*%PSRWS
Segura (en la foto), indicó que
debido a las iniciativas del rubro extractivo que están entrando en su fase operativa, la
producción minera continuará
impulsando el crecimiento de
la economía peruana en los
próximos dos años.
“Habíamos dicho hace más de
año y medio que la producción
minera sería importante en el
2015 y continuará siéndolo
en el 2016 y 2017 por todos
los proyectos existentes. El impulso de la producción se
apreciará de manera sostenida en el tiempo en los siguientes 24 meses”, señaló el secretario de Estado.
La autoridad del gobierno peruano destacó que además
de Las Bambas -iniciativa que comenzó su producción en
diciembre del 2015 con algunos envíos de prueba, pero
que alcanzará una producción plena de 450,000 tonelaHEWQqXVMGEWHIGSFVI½RSTSVEyS'SRWXERGME'YWGS
PEWEQTPMEGMSRIWHI'IVVS:IVHI%VIUYMTE]%RXEQMRE
(Áncash), además de Toromocho (Junín); lograrán sostener la economía del país.
nme 44 marzo
BREVES VISION 44-45.indd 44
08-03-16 11:57
Organismo colombiano
alerta presencia de mercurio
en ríos por minería ilegal
La Defensoría
del Pueblo de
Colombia, organismo defensor
de los derechos
humanos, alertó
sobre la contaminación de
fuentes hídricas
debido al mercurio que es utilizado en los trabajos de
la minería ilegal en ese país, especialmente en el departamento del Chocó, en la frontera con Panamá.
De acuerdo a la información recopilada por el organismo, al menos ocho ríos (Atrato, San Juan, Andágueda,
Apartadó, Bebará, Bebaramá, Quitó y Dagua) han sido
contaminados y su cauce ha sido desviado por la intervención abrupta e irregular de los complejos mineros.
“Las consecuencias del vertimiento de mercurio sobre
los ríos y la dispersión de los vapores que arroja su
tratamiento en los entables, son situaciones que representan un alto riesgo para la salud de la comunidad”,
indicaron desde la Defensoría del Pueblo de Colombia.
Cabe recalcar que el agua de los ríos mencionados es
utilizada para el consumo directo, la pesca y el baño de
las comunidades que habitan en las riberas de estos
E¾YIRXIW
Olami Honduras proyecta el cierre
de al menos 4 empresas mineras
De acuerdo a las proyecciones del Organismo Latinoamericano de Minería (Olami) para Honduras, al menos cuatro
empresas del rubro podrían cerrar sus operaciones este año
en el país centroamericano, debido a la baja del precio de los
metales en los mercados internacionales, por lo que, según
indican desde Olami, al menos unos cuatro mil empleos se
perderían en ese país.
“Las empresas mineras en Honduras están pasando por graves problemas en sus costos operativos a tal extremo que
si no se toman medidas heroicas o se buscan alternativas
por parte del gobierno, estas minas tendrán que tomar sus
propias medidas que van en contra de la situación de los
XVEFENEHSVIW²E½VQzIPTVIWMHIRXIHI3PEQMIR,SRHYVEW
Santos Gabino.
Según el dirigente, las minas con mayor riesgo a cerrar serían
El Mochito, El Corpus, Minerales de Occidente y Agalteca.
marzo 45 nme
BREVES VISION 44-45.indd 45
08-03-16 15:21
ERNC, pisando fuerte
Las energías renovables no convencionales prometen seguir jugando un
rol cada vez más importante en la escena energética local. Sin embargo, el
sector de las ERNC aún debe enfrentar varios desafíos para seguir creciendo.
¿Cuáles? Las restricciones en transmisión y un mercado con costos
marginales más bajos, pueden ralentizar el alza de estas tecnologías.
Daniela Tapia
nme 46 marzo
ENER ERNC 46-49.indd 46
07-03-16 17:50
S
Sin embargo, las señales positivas para
las ERNC continuaron, especialmente
después que en septiembre de 2013
se aprobara la propuesta que exigía a
la industria que el 20% de la energía de
la matriz fuera renovable el año 2025
(conocida como la norma 20/25).
Y el fenómeno comenzó a tomar forma.
Si en 2010 las ERNC aportaban sólo el
3,4% del total de la capacidad instalada
del país, el 2014 este tipo de energías ya
representaba el 10% de la generación
de electricidad. Sólo entre los años 2014
y 2015 se incorporaron 1.500 MW de
capacidad instalada de fuentes ERNC al
SIC y al SING, según la Asociación Chilena de Energías Renovables (Acera).
Costos a la baja
Entre las razones que explican este
boom está que el costo de las ERNC ha
continuado a la baja, y desde hace unos
años ya es claramente más bajo que
las fuentes de generación convencional
termoeléctricas, según destaca Carlos
Finat, director ejecutivo de Acera.
Una visión en la que coincide Raimundo
Bordagorry, académico del Centro de
Energía y Desarrollo Sustentable de la
Universidad Diego Portales, quien agrega que particularmente, el precio de los
módulos solares fotovoltaicos tiende a
caer un 20% cada vez que se duplica su
volumen de ventas acumulado.
“Las células que conforman los paneles
XEQFMqRLERMHSMRGVIQIRXERHSWYI½ciencia en función de la adopción de sus
cuatro sucesivas generaciones tecnológicas, y han experimentado una caída en
su precio desde los US$120.76 por watt
en 1977, hasta los US$0,7 por watt en
2017”, dice.
Pero el factor crucial que permitió la
mayor integración de fuentes ERNC al
WMWXIQE JYI PE QSHM½GEGMzR E PEW FEWIW
de licitaciones de suministro para distribuidoras.
%WuPSVEXM½GE1EVGIPS1EXYWWYFHMVIGtor del Centro de Energía de la Universidad de Chile, tras señalar que las
licitaciones han permitido dar un marco
claro para que nuevos actores ingresen
al mercado.
Es más. Una de las medidas más relevantes para el crecimiento de este tipo de
energías ha sido la inclusión de bloques
horarios en las licitaciones para distribuidoras. La razón, a juicio de Acera, apunta
a que los contratos de suministro a las
distribuidoras de largo plazo y bajo riesgo son muy atractivos para la industria
)62']EUYIJEGMPMXERIP½RERGMEQMIRXS
de los proyectos nuevos.
“Un beneficio adicional de las licitaciones de suministro para distribuidoras es que al ser públicas las
ofer tas, han ayudado a derribar el
mito de que las ERNC serían caras”,
Foto: Joaquín Ruiz
i hace diez años las ERNC aparecían
muy tímidamente en la escena local, el
panorama de hoy es completamente
distinto. Ávidas de abrir nuevos mercados, varias compañías internacionales
han apostado fuerte por Chile para desarrollar proyectos de energía renovable. La razón es muy sencilla: el país goza
de condiciones naturales envidiables
para la puesta en marcha de iniciativas
de esta naturaleza. Pero el camino no
ha sido fácil.
Vistas como iniciativas simbólicas, fueron las circunstancias y la cada vez mayor evidencia de los efectos del calentamiento global, las que cambiaron la
mirada sobre las ERNC.
Si el corte de gas proveniente desde
Argentina en la década del 2000 ayudó
a impulsar tímidamente a las ERNC, la
Ley 20.257 de Servicios Eléctricos que
se aprobó en 2008, estableció las primeras exigencias en la materia. La meta
entonces era que el 10% de la energía
del mercado proviniera de fuentes renovables no convencionales.
Dos años después, el gobierno de la
época anunciaba que era necesario incrementarla aún más, elevándola a 20%.
La oferta sonaba atractiva para iniciar
un camino de desarrollo. Pero también
había dudas si se lograría la meta, debido a la baja presencia de proyectos limpios en la industria generadora.
Planta de energía solar
fotovoltaica “María Elena”,
ubicada en la Región de
Antofagasta, que fue inaugurada
en mayo del año pasado.
marzo 47 nme
ENER ERNC 46-49.indd 47
07-03-16 17:50
Foto: Acera
Foto: U. Diego Portales
Foto: U. de Chile
“La interconexión SIC-SING permitirá
vender la energía renovable que
se produce en el norte -mayormente
solar- hacia el sur, aumentando
su mercado potencial”.
“Las células que conforman los paneles
han incrementado su eficiencia (…) y han
experimentado una caída en su precio
desde US$120.76/watt en 1977 hasta
US$0,7/watt en 2017”.
“Observando la cantidad de proyectos
ERNC que actualmente están en construcción -cerca de 3.000 MW-, la tendencia
de crecimiento de la capacidad instalada
debería mantenerse en dos dígitos”.
Marcelo Matus, sub director del Centro
de Energía de la U. de Chile.
Raimundo Bordagorry, académico del Centro
de Energía y Desarrollo Sustentable de la UDP.
Carlos Finat, director ejecutivo de la Asociación
Chilena de Energías Renovables (Acera).
argumenta el director ejecutivo de la
entidad, Carlos Finat.
Sin embargo, advierte Raimundo Bordagorry, de la Universidad Diego Portales,
hoy se genera el problema, que en horarios donde hay una fuerte presencia
del sol, hay sectores con costo marginal
cero, debido a la alta disponibilidad de
energía solar, por lo que los proyectos
de esta naturaleza que no tienen PPA
(Power Purchase Agreement), están en
problemas.
Pese a ello, de lo que no hay duda es
que estas energías han logrado competir mano a mano con las de tipo convencional debido que a diferencia de
otros países, en Chile no hay subsidios.Y
aunque en la actualidad su penetración
aún es pequeña, es posible asegurar que
ésta será cada vez más fuerte y con proyecciones de más largo plazo.
Por su parte, la ley de fomento de ERNC
ha reconocido formalmente el aporte de
éstas al sistema, con la exigencia de un
porcentaje mínimo de generación renovable para todos los participantes. Una medida que ha puesto en marcha el mercado
de “bonos verdes”, en que cada empresa
puede vender su generación renovable a
una empresa que no la tenga, cuya tendencia a futuro parece ir al alza.
Y si hay un factor que podría poner en
aprietos al sector es la crisis que está
experimentando el precio del petróleo,
donde es posible que las ERNC se vean
EJIGXEHEWTSVPEW¾YGXYEGMSRIWHIPQIVcado energético, al igual que todas las
empresas de energía.
“Si el petróleo sigue en el rango de los
30 o 40 dólares por barril por un largo
plazo, el escenario se puede poner más
difícil para todas las empresas generadoras que venden al sistema sin contratos, sean o no renovables”, asevera
Marcelo Matus, del Centro de Energía
de la Universidad de Chile.
como es el caso de la eólica y solar foXSZSPXEMGEWITYIHILEGIVQjWI½GMIRXI
y por mayores cantidades.
A esto se suma que la interconexión
permitirá vender la energía renovable
que se produce en el norte -mayormente solar- hacia el sur, aumentando
su mercado potencial.
“La apertura hacia el sur permitirá que
los embalses de esta zona cumplan una
JYRGMzR HI VIWIVZE ERXI PEW ¾YGXYEGMSnes de las energías renovables, lo que
tendrá como consecuencia una mejor
integración de las ERNC al sistema”,
comenta Marcelo Matus, del Centro de
Energía de la Universidad de Chile.
Mientras que la nueva política energética “Energía 2050” le otorga un rol
protagónico a las ERNC en la futura
matriz energética del país, estableciendo
un piso de al menos un 40% de ERNC
para 2035 y de un 60% para 2050. Algo
que en Acera sostienen que puede ser
WYTIVEHS ] UYI ±VIWYPXEVuE I½GMIRXI ]
seguro para el país lograr que su matriz
de generación sea 100% renovable para
IPEyS²E½VQER
Interconexión SIC-SING
y Energía 2050
No hay duda que el escenario energético local vive un momento auspicioso,
gracias a una serie de iniciativas que
prometen revitalizar al sector, entre
las que destacan la interconexión SICSING, la tramitación de la nueva ley
de transmisión y la ya vigente política
“Energía 2050”.
Ante esta nueva etapa, bien vale la pena
preguntarse en qué situación quedarán
las ERNC y cómo se ajustarán a este
escenario. Para Carlos Finat, de Acera, la
interconexión SIC-SING tiene la ventaja, entre otras, de constituir un sistema
eléctrico de mayor tamaño y diversi½GEGMzR HI WYW JYIRXIW TSV PS UYI PE
integración de fuentes ERNC variables,
Desafíos
A pesar de este auspicioso panorama,
este tipo de energías no están exentas
de problemas. Uno de ellos son las restricciones en transmisión y un mercado
nme 48 marzo
ENER ERNC 46-49.indd 48
07-03-16 17:50
Foto: Acera
con costos marginales más bajos que
pueden ralentizar el alza de estas tecnologías.
Una realidad que preocupa al gremio
que agrupa a las energías limpias, ya
que de extenderse las restricciones de
transmisión, una de las teorías que se
barajan es que se podría enviar una señal a los inversionistas para que dilaten
sus proyectos y busquen nuevos lugares para desarrollarlos, en los cuales los
recursos renovables tal vez no sean los
óptimos.
Es por esto que en Acera argumentan
que hay algunas medidas paliativas que
se podrían implementar en el corto plazo. Dentro de ellas está la idea de maxiQM^EV PE ¾I\MFMPMHEH HIP TEVUYI KIRIrador termoeléctrico, evitando así que
restricciones de las centrales termoeléctricas impongan un uso innecesario
del sistema de transmisión. También
piensan que en el nuevo proyecto de
ley de transmisión es posible incorporar mecanismos que compensen a los
generadores que resultan limitados en
su generación debido a congestiones de
transmisión.
Una opinión de la que discrepa Marcelo
Matus, sub director del Centro de Energía de la Universidad de Chile, ya que si
bien un mercado con bajos costos marginales puede afectar ciertas decisiones
de inversión de ERNC, en general los
proyectos de energía son a largo plazo
-15 a 20 años- y su estructura comercial
de venta no depende directamente del
costo marginal (un ejemplo de esto son
las propias licitaciones), por lo que las
¾YGXYEGMSRIWHIIWXIGSWXSRSRIGIWEriamente deben tener un impacto en la
evaluación de todas las inversiones del
área.
En cuanto a las restricciones de transmisión actuales, el especialista plantea
que es de esperar que mejoren con la
interconexión SIC-SING y las distintas
proyecciones estipuladas para el sistema troncal.
±4EVEHzNMGEQIRXIHEHEPE¾I\MFMPMHEHHI
la energía solar para encontrar lugares
de instalación, en especial en el norte,
ésta podría aprovechar las restricciones
impuestas por la transmisión para ser
más competitiva”, explica Matus.
Y de no adecuar la forma de comercializar la energía y sólo apostar por la
fórmula de costos marginales, “se verán
HM½GYPXEHIWHILIGLSPSWTVS]IGXSWWSlares ya están en problemas”, explica
Raimundo Bordagorry, de la Universidad Diego Portales.
Visto este escenario, ¿cómo se proyecta el próximo proceso de licitación
de suministro eléctrico, y el panorama
de las ERNC en 2016? El proceso de
licitación de 2016 se augura competitivo, pues esa tendencia debería profundizarse en una competencia por
un bloque de energía licitado casi 10
veces más grande.
“Observando la cantidad de proyectos
ERNC que actualmente están informados en construcción, cerca de 3.000
MW, la tendencia de crecimiento de la
capacidad instalada debería mantenerse
en dos dígitos”, expresa Carlos Finat, de
Acera.
Así las cosas, y aún con desafíos pendientes, todo parece indicar que las
ERNC aumentarán su participación sigRM½GEXMZEQIRXI IR PSW TVz\MQSW EySW
demostrando que este tipo de energías
seguirán pisando fuerte en el escenario
energético local.
Durante los años 2014 y 2015 se
incorporaron 1.500 MW de capacidad
instalada de fuentes ERNC al SIC
y al SING, según la Asociación
Chilena de Energías Renovables.
marzo 49 nme
ENER ERNC 46-49.indd 49
07-03-16 17:50
ERNC: ¿de paso o llegaron para quedarse?
Por Ramón Galaz,
Gerente General Valgesta Energía
“Si se logran manejar
adecuadamente
algunas amenazas que
enfrenta este mercado,
es posible asumir que
la participación de
las ERNC aumentará
significativamente en los
próximos dos o tres años
e incluso podría llegar a
triplicarse en un plazo
cercano a los diez años”.
El 2015 fue un año importante dentro del proceso de consolidación de
las Energías Renovables No Convencionales (ERNC) en nuestro país.
Por una parte, estas tecnologías aumentaron su participación en la matriz nacional con un aporte de 5.879 GWh, equivalentes al 8.2% del
total de la energía total producida, porcentaje que además se encuentra
por sobre la obligación establecida para este año en la ley, tal como ha
venido sucediendo desde el inicio de su aplicación en 2010.
Adicionalmente, las ERNC tuvieron un importante rol en los procesos de licitación de las empresas distribuidoras, en diciembre de 2014
y octubre de 2015, adjudicándose bloques de energía equivalentes a
2.915 GWh y 1.200 GWh respectivamente, a precios promedios de
102 US$/MWh y 79.3 US$/MWh, los que resultaron ser cerca de un
30% más bajos que los precios adjudicados en procesos inmediatamente anteriores.
Frente a esta situación, cabe preguntarse si esta evolución que han mostrado las ERNC se mantendrá en el tiempo o sólo se trata de un hecho
puntual que obedece a situaciones coyunturales del mercado como lo
fueron los altos precios de la energía, períodos extensos de sequía y
baja en los costos de inversión de estas tecnologías.
Todo indica que no se trataría de algo coyuntural, sino más bien estructural. En efecto, al analizar las condiciones actuales y futuras de este
QIVGEHS IW TSWMFPI IRGSRXVEV VE^SRIW WY½GMIRXIW GSQS TEVE TIRWEV
que el aporte de las ERNC se incrementará, al menos en el corto plazo.
En primer lugar, se espera que sus costos de inversión sigan con una
tendencia a la baja, quizás no con la fuerza que hemos visto en los
últimos años, pero si a tasas que permitan una baja de estos costos de
entre un 5% y 10% en los próximos cinco años, según estiman diversos
analistas.
%HMGMSREPQIRXI I\MWXI YRE GEVXIVE HI TVS]IGXSW GSR GEPM½GEGMzR EQbiental favorable que supera los 18.000 MW en el sistema, y si bien no
IWTSWMFPIE½VQEVUYIXSHSWIPPSWWIGSRGVIXEVjRWuIWVE^SREFPIEWYQMV
que al menos una parte, aunque sea menor, sí lo hará. Finalmente, y
quizás lo más importante, está el hecho de que a la capacidad instalada
existente se deben agregar los proyectos que se encuentran actualmente en construcción, que suman cerca de 2.815 MW. Sólo estos últimos
estarían en condiciones de producir del orden de 5.800 GWh al año, lo
que duplicaría su aporte actual.
En consecuencia, y si se logran manejar adecuadamente algunas amenazas que enfrenta este mercado que esta columna no analiza, es posible
EWYQMVUYIPETEVXMGMTEGMzRHIPEW)62'EYQIRXEVjWMKRM½GEXMZEQIRXI
en los próximos dos o tres años e incluso podría llegar a triplicarse en
un plazo cercano a los diez años, mostrando así que las ERNC no están
de paso, sino más bien llegaron para quedarse.
nme 50 marzo
COL GALAZ 50.indd 50
08-03-16 15:20
Avisos.indd 1
07-03-16 15:02
Foto: Abengoa
Abengoa:
Enfrentando
la emergencia
Valorada por ser una de las compañías
más importantes en el campo de las
energías renovables en España, Abengoa
enfrenta uno de sus peores escenarios
dado su alto nivel de deuda. Hoy, bajo un
estricto plan de reestructuración, venta
de activos y renegociación, la compañía
española espera salir a flote.
Daniela Tapia
C
on una destacada presencia en España, la compañía
Abengoa se ha posicionado como un referente en el desarrollo de diferentes soluciones industriales. Ligada a la
familia Benjumea, que todavía controla un 57% del capital,
su negocio histórico siempre ha sido el de la ingeniería y
la construcción de proyectos en el sector energético y el
del agua. Un área que hoy le sigue repor tando un 70% de
sus ingresos.
Tal ha sido su éxito que le ha permitido convertir un mercado
de difícil acceso como Estados Unidos en su principal foco
de negocio, con 1.364 millones de euros en ventas durante
el 2015.
Su segundo gran pilar de negocio está orientado a la producción industrial, centrada en biocombustibles y el desarrollo tecnológico, con ingresos de 1.614 millones en 2015.También está
vinculada al negocio concesional en infraestructuras de agua,
cogeneración y líneas de transmisión eléctrica.
4IVS NYWXEQIRXI WY RMZIP HI HMZIVWM½GEGMzR LE MQTEGXEHS IR
WYWSTIVEGMSRIW½RERGMIVEWTVMRGMTEPQIRXIIRWYEPXSRMZIPHI
deuda que la tiene “en el limbo”.
De hecho, según lo que se ha comentado, el origen de sus problemas se debería a la “falta de entendimiento” por parte de
los inversionistas internacionales sobre los mecanismos “complejos” que utiliza el grupo para captar fondos del mercado.
Una situación que ha situado a la compañía en una verdadera
montaña rusa bursátil.
Y es que Abengoa inició su expansión en el negocio de
las energías renovables en España, bajo las suculentas
subvenciones a este tipo de energías que aprobó el gobierno del ex presidente español, José Luis Rodríguez
Zapatero.
Fue así como el grupo construyó varias centrales termosolares
en Andalucía, donde mantiene su sede social, y adquirió el nivel
tecnológico necesario para lanzarse a la conquista internacional.
nme 52 marzo
ENER ABENGOA 52-53.indd 52
08-03-16 15:19
Hoy en día, el 77% de sus ingresos proceden del negocio a nivel mundial.
Pero su crecimiento empresarial implicó
un fuerte aumento de su volumen de
deuda, la que se estima es superior a
los 9.000 millones de euros, por lo que
WYWGSWXSW½RERGMIVSWRSLERTEVEHSHI
GVIGIVTIWIEUYIPEIQTVIWELEPSKVEdo sostener sus ventas.
Proceso de reestructuración
Preocupados por este panorama y para
EREPM^EVIWXEGVuXMGEWMXYEGMzRE½RIWHI
enero la consultora Alvarez&Marsal
presentó ante el Consejo de Administración de Abengoa, el plan de viabilidad
UYIHI½RIPEIWXVYGXYVEHIPEEGXMZMHEH
futura de la compañía.
)P RYIZS PMRIEQMIRXS GSR½VQE UYI
Abengoa continuará siendo una compañía viable y rentable.
“El Consejo de Administración de
%FIRKSELEEGSVHEHSTVSGIHIVEPERIgociación de la reestructuración de su
deuda y los recursos necesarios para así
continuar su actividad de forma competitiva y sostenida en el futuro”, señaló la
½VQETFPMGEQIRXI
)WXI EGYIVHS WIKR WI HIWTVIRHI
del comunicado- “debe alcanzarse
antes de que finalice el período marcado por el procedimiento “5bis”
dado que una situación de concurso
implicaría una destrucción de valor
para acreedores y accionistas muy
superior a la de cualquier escenario
de continuidad, todo ello sin evaluar
el enorme costo social que tal situación implicaría”.
A nivel operativo la compañía desarrollará su negocio concentrándose en las
actividades de ingeniería y construcción
con tecnología propia o de terceros. Así,
sus necesidades de caja tras la venta de
activos serían de 826 millones de euros
en 2016 y de 304 millones de euros en
2017. Del mismo modo, la compañía
reconoce que necesita garantías adicionales de 525 millones en estos dos
ejercicios.
El plan de viabilidad también contempla
desinversiones de activos no estratégicos que tendrían un impacto positivo en
la cuenta de resultados de 473 millones
entre 2016 y 2017. Por otra parte, también se contempla reducir los costos
operativos de la empresa desde los 450
QMPPSRIWIRLEWXEPSWQMPPSRIW
en 2018.
De esta manera, “la nueva Abengoa”
(como se le llama oficialmente) podría generar un flujo de caja de 700
QMPPSRIWHIIYVSWLEGMEIPEyS
%HIQjWLETPERXIEHSEWYWEGVIIHSres financieros que se queden con el
95% de la compañía a cambio de la
condonación del 70% de su deuda
corporativa.
Vistas así las cosas, bajo un estricto plan
HI VIIWXVYGXYVEGMzR PE ½VQE IWTEySla está revisando punto por punto los
avances de sus proyectos más imporXERXIW UYI IWXj HIWEVVSPPERHS IR 'LMle (ver crónica aparte sobre proyectos
Atacama 1 y 2).
marzo 53 nme
ENER ABENGOA 52-53.indd 53
08-03-16 15:19
Foto: Abengoa
Proyectos Atacama
Solar bajo la lupa
Tras el plan de viabilidad que está aplicando la firma Abengoa,
desarrolladora de los complejos solares Atacama 1 y 2 para definir
la actividad futura de la empresa, la compañía ha reconocido que
las obras de ambas iniciativas se ralentizarán, pero no afectará el
suministro comprometido en las licitaciones eléctricas.
Daniela Tapia
Q
ue Abengoa está atravesando por un momento complejo, no hay duda de ello. Bajo un estricto plan de reestructuVEGMzRZIRXEHIEGXMZSW]VIRIKSGMEGMzRHIWYHIYHEPE½VQE
española, especializada en desarrollar proyectos en las áreas
de energía y medioambiente, está revisando punto por punto
los avances de sus proyectos más importantes que está desarrollando en Chile.
Y es que en la actual cartera de proyectos de la compañía
½KYVERHSWMRMGMEXMZEWGSRHMWXMRXSWKVEHSWHIEZERGIW7IXVEXE
HIPSWGSQTPINSW%XEGEQE7SPEV]UYIIRGSRNYRXSWYQER
YREMRZIVWMzRIWXMQEHEHI97QMPPSRIW
)RVIPEGMzRE%XEGEQE7SPEVIRIRIVSHIPE½VQEHMS
MRMGMSS½GMEPEPEGSRWXVYGGMzRHIPTVS]IGXSYFMGEHSIRPEGSQYREHI7MIVVE+SVHE6IKMzRHI%RXSJEKEWXEHI1;IP
QjWKVERHIHI0EXMRSEQqVMGEIPGYEPIWXEVjJSVQEHSTSVPE
TVMQIVETPERXEXIVQSWSPEVHI%QqVMGE0EXMRE1;]TSV
YRETPERXEJSXSZSPXEMGE1;
(IRXVS HI WYW GEVEGXIVuWXMGEW XqGRMGEW PE TPERXE JSXSZSPXEMGE
GSRWXEVj HI TERIPIW UYI GETXEVjR PE IRIVKuE HIP WSP
para transmitirla directamente a la red.
4SV WY TEVXI PE TPERXE XIVQSWSPEV XIRHVj LIPMSWXEXSW
GSRYREWYTIV½GMIXSXEPTEVEIPGEQTSWSPEVHIQjWHI
hectáreas. Los heliostatos concentran la radiación solar en un
punto, el receptor, ubicado en la parte superior de una torre
HIQIXVSWHIEPXYVE0EVEHMEGMzRHIPWSPIRXERXSWIIQTPIETEVEGEPIRXEVWEPIWJYRHMHEWUYIWIYXMPM^ERTEVEKIRIVEV
ZETSV GSR IP UYI WI EPMQIRXE YRE XYVFMRE HI 1; UYI
genera electricidad limpia.
)P GSQTPINS TVIXIRHI IZMXEV PE IQMWMzR HI YREW XSRIPEHEW HI '3 EP EyS ] VIWTSRHIV E PE HIQERHE HI IRIV-
Maqueta del proyecto
Atacama 1, proyecto “estrella”
de Abengoa Solar en Chile.
nm
nme
n
me
m
e 54
5 4 ma
m
marzo
arz
rz
zo
o
ENER ATACA 54-55.indd 54
07-03-16 17:50
gía gracias a la combinación de ambas tecnologías desde una
perspectiva sustentable y estable.
¿Pero cómo se verá afectado el plan de trabajo de sus proyectos en medio del escenario de incertidumbre que enfrenta la
compañía? La empresa ha planteado que en el caso de Chile,
se ralentizarán algunas obras del complejo solar Atacama 1,
su proyecto más destacado, pero no afectaría el suministro
comprometido en las licitaciones eléctricas.
“En cuanto a los proyectos de generación de energía, se ralentizan algunas obras del complejo solar Atacama 1, pero
esto no afectaría el suministro comprometido en las licitacioRIWIPqGXVMGEW0SWTVS]IGXSWIRIPTMTIPMRIWuWIIWXjRVIHI½RMIRHSERMZIPPSGEP²TPERXIzPE½VQE
Atacama 2 en la mira
La situación es preocupante, por lo que según informaron
desde la Comisión Nacional de Energía (CNE), se mantenHVjRQSRMXSVIERHSPEWMXYEGMzR]EUYIEHIQjWPE½PMEPPSGEP
de la multinacional se adjudicó el 25% de los 1.200 GW/h
subastados en la última licitación, los que deben comenzar a
ser suministrados en 2017.
Desde Abengoa Chile no es mucho lo que pueden informar
debido a que se trata de una situación -que aunque afecta a
su matriz- está lejos de su alcance. Sin embargo, explicaron
públicamente que -al menos por el momento- las labores de
construcción de Atacama 1 se mantendrán sin cambios, ya
que sigue con su cronograma.
(IPEQMWQEJSVQEPE½VQE]EGYIRXEGSRPE6IWSPYGMzRHI
'EPM½GEGMzR %QFMIRXEP 6'% JEZSVEFPI TEVE HIWEVVSPPEV WY
proyecto Atacama Solar 2 -también ubicado en Sierra Gorda-,
para el cual considera una inversión de US$1.200 millones,
EYRUYIqWXIERRSGYIRXEGSRYRGVSRSKVEQEHI½RMHSHI
ejecución.
En su peak de construcción Atacama 2 daría empleo a unas
2.000 personas, de allí su importancia a nivel regional.
Y es que para la compañía la puesta en marcha de ambos
proyectos es relevante dado su acento puesto en la innovación. Así, éstos disponen de un sistema pionero de almacenamiento térmico en sales fundidas diseñado y desarrollado
por Abengoa, “lo que otorga a esta tecnología un alto grado
de gestionabilidad, pudiendo suministrar electricidad de forma
estable las 24 horas al día y permitiendo responder a todos
los períodos de demanda de consumo energético”, destaca
PE½VQE
Estas plantas, asimismo, contarán con un sistema de gestión
de la energía producida con ambas tecnologías -termosolar
y fotovoltaica-, que supondrá un avance en la integración de
las energías renovables en la red eléctrica mediante la incorporación de este servicio auxiliar al gestor de la red eléctrica.
¡'YjPWIVjIPJYXYVSHIPSWTVS]IGXSWQjWMQTSVXERXIWUYIPE½VQE
está desarrollando en Chile? La respuesta aún es incierta, pues la
TVMSVMHEHIWXjTYIWXEIRPEWSFVIZMZIRGME½RERGMIVEHI%FIRKSE
una delicada encrucijada que condiciona su viabilidad.
marzo 55 nme
ENER ATACA 54-55.indd 55
07-03-16 17:50
ERNC:
Hacia su integración
sistémica y su óptimo
desarrollo
Analizar el avance de las energías renovables en el país,
la experiencia de las firmas de transmisión eléctrica
en la conexión de proyectos de ERNC y su relación
con las comunidades y el financiamiento de este tipo
de iniciativas, son los tópicos que se analizarán en el
marco de un seminario que organizará Revista Nueva
Minería y Energía en abril próximo.
Daniela Tapia
nme 56 septiembre
ENER SEM 56-57 FINAL.indd 56
08-03-16 15:59
A
lcanzar altos niveles de participación ciudadana para que
los proyectos energéticos se puedan concretar, es uno de los
objetivos de la Agenda de Energía que lanzó el gobierno durante 2014. La idea apunta a que tanto las empresas como los
distintos actores que se vean involucrados en el desarrollo de
proyectos de este tipo puedan dialogar y generar acuerdos
que permitan un diseño armónico de las iniciativas en sus dimensiones más importantes: económicas, técnicas, sociales y
ambientales.
Y es que fomentar la relación con las comunidades se ha convertido en un lema del sector energético, para que las distintas
iniciativas lleguen a buen puerto. Un tema sensible para la industria que ha estado presente en diferentes foros sectoriales, y
que pretende ser analizado con profundidad en el marco de un
seminario técnico especializado que organizará Revista Nueva
Minería y Energía junto a CTG Energía el próximo 21 de abril,
en el Hotel Intercontinental de Santiago.
¿El foco? Analizar el avance de las energías renovables en el
TEuWPEI\TIVMIRGMEHIPEW½VQEWHIXVERWQMWMzRIPqGXVMGEIRPE
conexión de proyectos de ERNC y su relación con las comuRMHEHIW]IP½RERGMEQMIRXSHIIWXIXMTSHIMRMGMEXMZEW
Para ello, hace ya varios meses que se adjudicó la construcción
de una línea de transmisión en 500kV entre las subestaciones
Cardones y Polpaico, con una capacidad de transmisión de
1.500MVA que permite una efectiva conexión de la zona del
norte chico al SIC.
Sin embargo, el ambicioso proyecto, que incluye la construcción de un tendido de 753 kilómetros de extensión entre la
Tercera Región y la Región Metropolitana con una inversión
de US$1.000 millones, ha sufrido una dura oposición. De hecho, al cierre de esta edición, los alcaldes de Limache y Tiltil
presentaron un recurso de protección ante la Corte de Apelaciones de Santiago por la decisión de la dirección ejecutiva del
Servicio de Evaluación Ambiental (SEA) de dar por aprobado
el proyecto.
A esto se suma el proyecto de interconexión SIC-SING que ya
está en construcción, mientras que los CDEC han avanzado fuertemente en incorporar capacidad técnica predictiva y operativa
que permite maximizar el despacho de las centrales ERNC.
El rápido crecimiento que han experimentado en el último
tiempo las ERNC en el país plantea grandes desafíos, los que
se mantendrán durante los próximos años debido al enorme potencial que tiene Chile en esta
materia.
Pero el paso natural para incorporar plenamente estas centrales que, por la disponibilidad del recurso son intermitentes en
su ciclo diario de generación, es la incorporación de sistemas
de almacenamiento de energía en línea. Para ello, ya existe un
proyecto en el SING del orden de 110 MW que almacenará
energía mediante la conservación de calor en sales, lo que
permitirá llevar la generación de una central solar a un factor
de planta sobre 94,5%.
En efecto, se estima que el país tiene un potencial
de más de 1.865.000 MW en energía eólica, solar e
hidroeléctrica, además de 3.000 MW o más de energía geotérmica y otros 2.000 MW de biomasa, según
estimaciones del ministerio de Energía.
Asimismo, en la zona de Copiapó se está desarrollando un
proyecto fotovoltaico de 150 MW que, combinado con tecnología de almacenamiento solar térmico mediante sistemas
de torre de potencia con sales fundidas de 260 MW, proveerá
generación continua.
El seminario titulado “Las ERNC en Chile”, buscará analizar
el desarrollo de este tipo de energías en el país a ocho años
de la implementación de la Ley N° 20.257 que en ese entonces buscaba impulsar la generación de energía eléctrica con
fuentes de energías renovables no convencionales.
En este contexto, las ERNC han ido ganando terreno a pasos
agigantados en el país. Una realidad que promete abrirse más
espacios en la escena energética local, lo que abre oportunidades y desafíos que esperan abordarse en profundidad en el
próximo seminario que realizará Revista Nueva Minería y Energía, y que contará con la participación de destacados especialistas y ejecutivos del rubro.
Almacenamiento de energía,
una solución que promete
Otro tema que cobrará importancia en el encuentro será la
integración sistémica y almacenamiento de ERNC. Un escenario que intenta imponerse dado el creciente avance de estas
fuentes de generación limpia en la escena eléctrica local, y
cuyo desafío está en su incorporación efectiva al sistema.
Un encuentro organizado por la nueva Área de Conferencias
y Eventos que Revista Nueva Minería y Energía creó recientemente, la que durante el año desarrollará una serie de seminarios y eventos sectoriales que apuntan a ser un aporte en el
debate de temas como el desarrollo energético futuro del país.
septiembre 57 nme
ENER SEM 56-57 FINAL.indd 57
08-03-16 15:59
ERNC en Chile: experiencia y
desempeño a ocho años de la Ley 20.257
Por Juan Manuel Contreras S.
+IVIRXI+IRIVEP'8+)RIVKuE]I\WIGVIXEVMSINIGYXMZSHIPE'2)
“Habiendo recorrido la
etapa de maduración y
alcanzado costos muy
competitivos, el desafío
principal de Chile para
que el gran volumen
de proyectos ERNC ya
aprobados se materialice
es el desarrollo de los
sistemas de transmisión
de alta tensión”.
Tres mecanismos de incentivos al desarrollo de las ERNC han sido los
más utilizados en las distintas regulaciones: “Feed-In Tariff ”, “Subastas
Competitivas” y “Obligación de Cuotas”. Mientras el sistema de tarifa
especial regulada para ERNC ha sido utilizado en varios países europeos y fue el principal impulsor del explosivo desarrollo que tuvieron
estas tecnologías en el pasado reciente, el sistema de “Subastas Competitivas” para ERNC lo han adoptado países como Uruguay, Brasil y Perú.
En el caso de Chile, después de una larga discusión técnica, el país adoptó el año 2008 -en la ley 20.257- el sistema de “Obligación de Cuotas”,
con una meta original de 10% para el año 2024, la que se amplió el año
2013 a 20% para el año 2025.
Como resultado de la utilización de estos mecanismos, los países han
incrementado la participación de ERNC en su matriz energética. La
Unión Europea pasó de 8,5% el año 2004 a 16% el año 2014, teniendo
como meta alcanzar un 20% para el año 2020 (Directiva 2009/28/EC).
En Sudamérica también se han adoptado metas para la participación de
PEW)62'4IVHI½RMzGSQSSFNIXMZSWMRGSRWMHIVEVIPETSVXIHI
PEWGIRXVEPIWLMHVSIPqGXVMGEWQMIRXVEW'LMPI]%VKIRXMREWI½NEVSR
para el año 2025.
En Chile, la incorporación de las ERNC ha tenido un aumento vertiginoso pasando de 720 MW instalados el año 2011 a 2.806 MW en enero de 2016, existiendo a la fecha 2.815 MW en etapa de construcción y
18.389 MW en proyectos con RCA aprobada. De estos últimos 10.755
MW corresponden a solar PV y 5.966 MW a eólicas.
Un factor relevante para la explosiva incorporación de las ERNC ha
sido la constante disminución de sus costos de inversión, lo que se traHYGIIRGSWXSWYRMXEVMSWHIGVIGMIRXIWHIKIRIVEGMzR4SVINIQTPSPSW
TVIGMSWTVSQIHMSHIPEWWYFEWXEWIR4IVTEVEGIRXVEPIWWSPEVIWFENEVSR
de 225 US$/MWh (año 2010) a 48,1 US$/MWh (2016) y de 87 US$/
MWh a 37,7 US$/MWh, en el caso de las centrales eólicas.
Habiendo recorrido la etapa de maduración y alcanzado costos muy
competitivos, el desafío principal de Chile para que el gran volumen
de proyectos ERNC ya aprobados se materialice es el desarrollo de
los sistemas de transmisión de alta tensión. Estos fueron impulsados en
los sucesivos planes de expansión del sistema troncal a partir del año
MRGPYMHEPEPuRIEHIMRXIVGSRI\MzR7-'7-2+PSWUYIHIWTINEVjR
las congestiones y sus negativos efectos en los costos marginales y en el
despacho y conexión de las tecnologías ERNC.
)RTEVXMGYPEVPEPuRIEHIMRXIVGSRI\MzRHIFIWIVSFNIXSTVIJIVIRXIHI
estudios sobre el impacto en los niveles de transferencia seguros en
la propia línea y en el resto del sistema, incorporando a tiempo todos
los equipos requeridos, incluidos convertidores “back to back” si fuera
necesario.
Lo anterior, más la incorporación de tecnología especial en los CDEC
TEVE PE STIVEGMzR HI YR WMWXIQE GEHE ZI^ QjW GSQTPINS ] IR IP JYXYro próximo la instalación de sistemas de almacenamiento de energía
en línea, ayudarán a incrementar el nivel de penetración de las centrales
ERNC intermitentes, convirtiéndose en nuestro gran desafío de los años
próximos. Junto con esto, debemos velar por un desarrollo equilibrado
de nuestra matriz eléctrica para evitar altos costos marginales a futuro.
nme 58 marzo
COL CONTRERAS 58.indd 58
08-03-16 15:20
Avisos.indd 1
07-03-16 17:36
Ganancias de AES Gener
subieron 44% en 2015
La industria energética está atravesando por un buen momento al
igual que la compañía AES Gener, reportando una utilidad de US$
265 millones, un 44% mayor a la del 2014 que bordeó los US$ 184
millones.
Así, durante el 2015, AES Gener siguió consolidando su segunda
etapa de expansión por 1.256 MW, que incluye una cartera de proyectos de generación de energía eléctrica de diversas tecnologías,
además de dar inicio a proyectos de desalinización como nueva
línea de negocio.
Dentro de sus hitos más importantes está el término de la construcción de la Unidad V de Guacolda, central a carbón de 152 MW
en el SIC, que entró en operación comercial a mediados de diciembre de 2015, y la planta desalinizadora, de 4.800 m3/día adyacente a
Enel Green Power inicia
construcción de planta
fotovoltaica “La Silla”
La italiana Enel Green Power inició las obras
de construcción de la planta fotovoltaica “La
Silla”, de 1,7 MW en el norte del país, con
una inversión cercana a los US$ 3,4 millones.
El proyecto tiene un acuerdo de compra de
energía a largo plazo con el observatorio astronómico La Silla, que se entregará a través
del Sistema Interconectado Central (SIC).
“Se trata de la primera instalación fotovoltaica de escala comercial a nivel mundial
que combina el uso de innovadores módulos bifaciales e inteligentes con módulos
convencionales. El uso de estos paneles incrementará la generación entre un 5% y un
10% comparado con una planta fotovoltaica
tradicional”, ha señalado la compañía.
Una vez operativa, la planta será capaz de
generar aproximadamente 4,75 gigavatios
hora (GWh) al año, equivalentes a las
necesidades energéticas de aproximadamente 2.000 hogares y a más del 50% de
las necesidades anuales de consumo del
observatorio, evitando así la emisión a la
atmósfera de más de 2.000 toneladas de
CO2 al año.
la central Angamos en el SING, que inició su operación comercial en diciembre del año pasado.
%HIQjWPE½VQEHMSIPZEQSWEPEGSQIVGMEPM^Eción de energía desde Chile hacia Argentina en
febrero de este año.
GNL Mejillones tramita proyecto
de expansión por US$ 40 millones
Un papel importante jugará GNL Mejillones en
la industria al posicionarse como uno de los
terminales que recibirá el
gas natural proveniente
del extranjero, para luego procesarlo y enviarlo
a Argentina.
'SR IWXI ½R E ½RIW HI
IRIVS PE ½VQE GSRXVSPEda por Codelco y Engie
(ex Suez), envió a tramitación ambiental su plan
de expansión por US$
40 millones. ¿La idea? El
terminal puede aumentar
en un 50% los 187.000
metros cúbicos de capacidad, y la idea es que la
inversión tenga su licencia ambiental.
“Nuestra intención es no perder ningún día. Si en seis meses más
WINYWXM½GEIWXEMRZIVWMzR]I\MWXIHIQERHEGSQIR^EVjREHIWErrollarse las obras. Si se decide exportar más gas hacia Argentina o
se determina aumentar el gas en la matriz energética local, ya estaremos preparados con este proyecto que ingresó recientemente
su Declaración de Impacto Ambiental (DIA)”, sostuvo Jean-Michel
Cabanes, gerente general de GNL Mejillones.
nme 60 marzo
BREVES ENERGIA 60-63.indd 60
07-03-16 17:52
Energía solar se convierte en la mayor
ERNC en Chile y supera a la eólica
Las ERNC se han consolidado en el último tiempo en Chile gracias
a la irrupción creciente de las centrales fotovoltaicas. A las decenas de proyectos que se han inaugurado en los últimos meses se
suman varios otros prontos a entrar en operaciones tanto al SIC
como al SING.
(IEGYIVHSGSRPEWGMJVEWHIP'()'7-' IRPSUYIZEHIPEyS
las centrales fotovoltaicas generaron 0,162 TWh en el Sistema Interconectado Central, cifra levemente
superior al apor te de las unidades eólicas.
Así, la tecnología solar superó incluso al de las unidades mini-hidro reconocidas como ERNC en el SIC, que generaron
0,1236 TWh; y a las centrales de biomasa, que llegaron a 0,0203 TWh, cifra que es 28,3% menor a la del año anterior.
Asimismo, en lo que va del año, el aporte de las unidades solares creció 62,66% en relación con igual período del año
anterior, mientras que el de las eólicas también aumentó, pero en una magnitud menor.
En total, las energías renovables no convencionales elevaron su aporte entre el 1 de enero y el 8 de febrero en 7,7%,
en línea con el incremento de la capacidad instalada.
Aprueban permiso ambiental para
central hidroeléctrica Frontera
La Comisión de Evaluación de la Región del Biobío aprobó
el proyecto hidroeléctrico Frontera, que tendrá un costo de
US$300 millones y que pertenece a Energía Llaima, empresa cuya propiedad comparten las familias Claro, Said Somavía, Said Handal y Garcés.
La iniciativa considera una central hidroeléctrica del tipo
Run-of-River y tendrá una potencia instalada de 109,3 MW,
con un caudal de diseño de 750 m3/s. En cuanto a su ubicación, ésta se emplazará en las comunas de Los Ángeles y
Mulchén y se conectará al Sistema Interconectado Central
(SIC) a través de una línea en 220 kV hasta la línea CharrúaTemuco, de propiedad de Transelec, en un punto que debeVjWIVHI½RMHSTSVIP'()'7-'
±)PTVS]IGXSWINYWXM½GEIWIRGMEPQIRXITSVIPLIGLSHIUYI
el disponer de energía eléctrica limpia es una condición
necesaria para el crecimiento y desarrollo económico del
país”, destaca la empresa a través del estudio de impacto
ambiental (EIA) del proyecto.
Proyectos energéticos en construcción
se duplican en menos de dos años
Uno de los pocos sectores productivos que ha logrado sortear la desaceleración de la economía local es el energético, el cual ha demostrado dinamismo en medio de un contexto
deprimido. Así, al menos, lo avalan diversas cifras.
Según datos del Ministerio de Energía, a enero de 2016, había 56 proyectos en
construcción, los que implicaban una capacidad de 4.032 megawatts (MW) y una
MRZIVWMzRGIVGEREEPSW97QMPPSRIW)WXEGMJVEWMKRM½GEIPHSFPIVIWTIGXSHI
las 28 iniciativas que estaban en construcción a marzo de 2014, las que proyectaban
una capacidad de 1.949 MW y una inversión de US$ 5.900 millones.
Las últimas licitaciones de suministro, dicen expertos, son el principal factor que explica este incremento. Pero también ha incidido en este proceso que esas iniciativas
han sorteado sus respectivos procesos administrativos y judiciales.
Al desglosar los 4.032 MW de capacidad que representan los 56 proyectos en construcción, la fuente que predomina, por sí sola, es la térmica (1.364 MW), seguida de la solar (1.168 MW), la hidroelectricidad (964 MW), la eólica (488 MW) y otras ERNC (49 MW).
marzo 61 nme
BREVES ENERGIA 60-63.indd 61
07-03-16 17:53
Comité de ministros
mantiene resolución favorable
para construcción de
hidroeléctrica en Río Cuervo
Mantener la ResoluGMzR HI 'EPM½GEGMzR
Ambiental (RCA), pero
con algunas condiciones, fue la decisión
adoptada tras dos horas de análisis por el
Consejo de Ministros,
dando así luz verde al
proyecto de la central hidroeléctrica de Río Cuervo, en la
Región de Aysén.
En dicha reunión, los ministros de Energía, Minería, Economía,
Salud y Agricultura analizaron 11 recursos de reclamación
contra el proyecto, que fueron presentados por particulares
y organizaciones ciudadanas buscando impugnar la RCA entregada al proyecto por la Comisión de Evaluación Ambiental
de la Región de Aysén, el 10 de septiembre de 2013.
0SW VIGYVWSW ETYRXEFER E QEXIVMEW HI LMHVSPSKuE ¾SVE ]
fauna de ecosistemas terrestres y acuáticos, medio humano, paisaje y turismo, riesgo y normativa ambiental aplicable,
entre otros.
Según un comunicado publicado por el Ministerio de Medio
Ambiente, el Comité de Ministros acogió parcialmente las
reclamaciones relacionadas con fauna terrestre y riesgo.
Gobierno presentará política
energética para Aysén
Aysén cuenta con un potencial hidroeléctrico de 5.000
MW. Una verdadera “mina energética” que requiere ser
explotada, según el gobierno.
Es por esto que en abril, el Ministerio de Energía entregará el diagnóstico que dará una imagen más clara de las
condiciones del territorio y las necesidades de Aysén en
materia energética. Y a mediados de 2017 se prevé dará
a conocer la política energética para esa región, así como
para Magallanes.
Para Aysén, se modelaron dos escenarios de demanda
IRIVKqXMGEGSRHMWXMRXEWSTGMSRIWHIQIHMHEWHII½GMIRcia energética, recambio tecnológico y desarrollo productivo industrial.
En este sentido, Nicola Borregaard, jefa de la división de
Desarrollo Sustentable del Ministerio, explica que éstos
se cruzaron con otros seis escenarios de oferta energética que incluyen diversas escalas de proyectos, distintas
tecnologías eléctricas y térmicas, además de variadas alternativas de conexión entre sistemas eléctricos.
Colbún registra utilidades por
US$ 204,7 millones durante 2015
Cifras azules arrojó Colbún, una de las empresas generadoras más
importantes del país. Durante el año pasado, la compañía obtuvo
utilidades por US$ 204,7 millones, cifra que representa un alza de
148% respecto a los excedentes obtenidos en 2014.
Otro hecho destacado de Colbún el año pasado fue la adquisición
de la empresa Fenix Power Perú, a través de un consorcio donde participa con un 51% de la propiedad. Esto se da en el marco
del proceso de internacionalización y crecimiento impulsado por la
compañía hacia nuevos mercados de América Latina.
)R'LMPIIRXERXSPE½VQEXMIRILS]YREGEVXIVEHITVS]IGXSWTStenciales en distintas etapas de desarrollo. Uno de ellos es La Mina,
proyecto hidroeléctrico ubicado en la Región del Maule de 34 MW
con un avance del 46%. Esta iniciativa ERNC comenzó su construcción en enero de 2015 y se
espera su puesta en servicio a inicios de 2017.
nme 62 marzo
BREVES ENERGIA 60-63.indd 62
07-03-16 17:53
Engie invertirá US$ 308
millones a desarrollos
GHVXÀOLDOHQ&KLOH
Para potenciar su presencia a este lado del continenXIPEGSQTEyuE)RKMIHIWXMREVjYRSWºQMPPSRIW
IUYMZEPIRXIWE97QMPPSRIW TEVEIPHIWEVVSPPS
HITVS]IGXSWHIWY½PMEPIR'LMPI)'0 IPTVMRGMTEP
generador eléctrico del SING.
)P 'ETI\ FVYXS UYI HIWXMREVj PE GSQTEyuE E RMZIP
KPSFEPIWXIEySEWGMIRHIEºQMPPSRIW HIPSW
cuales €2.600 millones corresponderán a manteniQMIRXS]SXVSWºQMPPSRIWEEWTIGXSW½RERGMIVSW
Durante una presentación, la empresa explicó que
IP'ETI\TEVERYIZSWTVS]IGXSWHI)RKMIEPVIHIHSV
HIPQYRHSIRWIVjHIºQMPPSRIWHIPSW
cuales la peruana Enersur, con €130 millones; la
½PMEPFVEWMPIyE8&0)GSRºQMPPSRIW]PEMRKPIWE
']KRYWºQMPPSRIWVIGMFMVjRVIGYVWSWWMQMPEVIWEPSWHI)'0
0EIQTVIWEXEQFMqRERYRGMzIPMRMGMSHIYRTVSGIWS
de venta de activos a nivel internacional, con el que
FYWGEVjLEGIVGENETEVEHIWEVVSPPEVRYIZSWTVS]IGtos y enfrentar el momento económico global.
Proyecto Alto Maipo se pospone un
año y su nivel de avance alcanza un 24%
Un difícil momento está atravesando el proyecto
Alto Maipo, cuya propiedad comparten AES
Gener y Antofagasta Minerals. Y es que a
dos años del inicio de su construcción ya
suma doce meses de retraso.
Según explicaron desde la empresa, los retrasos se deben a un “inicio un poco más
lento de lo inicialmente estimado, debido
a la gran cantidad de permisos que tuvimos
que obtener durante sus primeras fases para
cumplir con la normativa medioambiental”.
Si en diciembre de 2014 Gener, controladora
HIPTVS]IGXSTVS]IGXEFEUYIIRXVI½RIWHISMRMGMSWHIP
el proyecto estaría listo para iniciar sus operaciones, las nuevas esXMQEGMSRIWETYRXEREUYIWIVjYREySHIWTYqWIWHIGMVIRXVI½RIW
HIIMRMGMSWHI
A diciembre de 2015, el proyecto alcanzaba un progreso de 24%,
equivalente a nueve kilómetros de avance de túneles.
marzo 63 nme
BREVES ENERGIA 60-63.indd 63
08-03-16 14:40
Foto: Incopesa
Gestión de relaves
El desafío constante de la
seguridad y la eficiencia
La rotura de un dique de contención minera en Brasil que generó el
mayor desastre ambiental del que se tenga memoria en ese país, volvió
a poner en el centro de la polémica el modo en que operan los relaves
en la minería. En Chile, las empresas a cargo de los 651 depósitos
catastrados se suman a los retos pendientes de este proceso.
Camila Morales
Depósito de relaves de Carmen de
Andacollo, de la compañía minera Teck.
nme
n
nm
me
m
e6
644 ma
m
marzo
arrzo
rz
zo
z
o
MEDIO GESTION RELA 64-67.indd 64
07-03-16 17:46
Foto: Soventto Ingeniería
De acuerdo a información de Sernageomin,
Chile produce 1.400.000 toneladas diarias
GHUHODYHVSRUODSURGXFFLyQGHFREUHÀQR
H
abitualmente rodeados de polémica, y bajo sospecha
constante de comunidades cercanas, los depósitos de relaves
están en el foco de atención de la ciudadanía, de la propia
industria, y ahora último, del Estado. Más todavía cuando ocurren derrames u otro tipo de incidentes que normalmente
van asociados a desastres ecológicos de gran impacto para el
ambiente.
Precisamente uno de los últimos episodios graves ocurrió en
noviembre pasado en Brasil, tras el colapso de la presa de
relaves de Minera Samarco -propiedad de Vale y BHP Billitonque sepultó por completo a un pueblo cercano y que dejó al
menos 17 muertos, además de una amplia zona contaminada
con residuos tóxicos, en el sureste del estado de Minas Gerais.
Las consecuencias fueron tan grandes que el gobierno braWMPIySRSHYHzIRGEPM½GEVIPHIWPEZIGSQSIPTISVHIWEWXVI
ecológico de la historia de Brasil, mientras que un informe de
la ONU constató que el lodo tóxico contaminó el suelo, los
ríos y el sistema de agua en un área de más de 850 kilómetros,
con una magnitud de daño ambiental que equivale a 20.000
piscinas olímpicas de lodo residual tóxico.
Chile no ha estado ajeno a este tipo de incidentes, ya que también
tiene un lamentable historial de derrames asociados a relaves, casi
siempre vinculados a su industria más importante: la minería.
La particular condición sísmica del país y la escasez hídrica son
dos factores claves a la hora de analizar la gestión de relaves
en Chile. Una gestión que no siempre estuvo presente en la
minería, lo que dio lugar a graves accidentes que dejaron consecuencias ecológicas e incluso pérdidas de vidas humanas.
Entre 1965 y 2010 se registraron 10 grandes fallas de tranques
de relave, con derrames propagados entre los 5 y 12 kilómetros. Una triste historia que la industria y el gobierno quieren
HINEVHI½RMXMZEQIRXIEXVjW
Para ello se trabaja constantemente en una serie de temas
donde aún hay desafíos latentes, como los aspectos geotécniGSWVIKYPEXSVMSWHIWIKYVMHEH]I½GMIRGME8SHSTEVEEPGER^EV
el objetivo principal: proteger la salud de las personas que viven cerca de estos depósitos y prevenir daños a bienes físicos
y al medio ambiente.
El diseño de estrategias para optimizar la gestión de relaves y
EWuIZMXEVPE½PXVEGMzRSIPEVVEWXVIHIQMPPSRIWHIXSRIPEHEWHI
cobre, arsénico, hierro, plomo, aluminio, entre otros metales
pesados, ya es una tarea prioritaria para las empresas mineras,
el gobierno en su rol regulador y para los expertos, enfocados
en la implementación de nuevas tecnologías.
¿Qué falta?
De acuerdo a información dada a conocer por Sernageomin
en agosto del año pasado, Chile produce 1.400.000 toneladas
diarias de relaves como consecuencia de la producción de coFVI½RS
Considerando que la “ley mineral” ha caído ostensiblemente,
y que a pesar de este descenso las reservas probadas de cobre permiten inferir que la producción minera seguirá al alza
durante al menos las próximas dos décadas; la proyección de
los relaves deduce un crecimiento exponencial, hecho que impone mayores retos en este proceso.
Así lo explica Christian Ihle, profesor del Departamento de
Ingeniería de Minas e Investigador del Centro Avanzado de
8IGRSPSKuETEVEPE1MRIVuEHIPE9RMZIVWMHEHHI'LMPIUYMIR
expone los temas pendientes a nivel geotécnico en materia de
gestión de relaves.
Para el experto, los mayores desafíos en esta área están relaGMSREHSWGSRPEIWXEFMPMHEHWuWQMGEPEQMRMQM^EGMzRHIMR½PXVEGMSRIW]IPYWSI½GMIRXIHIPVIGYVWSEKYE
marzo 65 nme
MEDIO GESTION RELA 64-67.indd 65
07-03-16 17:46
Foto: Archivo personal Sergio Prado
Foto: Felipe Pinto
Foto: Archivo personal
de Christian Ihle
“Los mayores desafíos están relacionados
con la estabilidad sísmica, la minimización
de infiltraciones y el uso eficiente del
recurso agua (…) Los depósitos de
relaves tienen el potencial de generar
infiltraciones, con un riesgo de
contaminación de acuíferos”.
“(La ley de cierre de faenas mineras) ha
dado herramientas a Sernageomin
para una fiscalización mucho más
rigurosa que la permitida por la antigua
normativa, lo que ha logrado mejorar
el estándar de los depósitos
actualmente en operación”.
“El desarrollo de equipos de gran
capacidad para filtrar relaves constituye
una gran innovación que permitirá
recuperar el máximo de agua posible,
con un mínimo de equipos de filtrado en
operación para tratar grandes tonelajes
y depositar los relaves en forma segura”.
Christian Ihle, profesor del Dpto.
de Ingeniería de Minas de la U. de Chile.
Rodrigo Álvarez, director nacional
del Servicio Nacional de Geología y Minería.
Sergio Prado,
Minerals Manager de FLSmidth.
“En el caso de la estabilidad de muros
está en juego la seguridad de la población, donde una falla puede tener
consecuencias fatales. Por otro lado, los
depósitos de relaves tienen el potencial
HIKIRIVEVMR½PXVEGMSRIWHSRHILE]YR
VMIWKSHIGSRXEQMREGMzRHIEGYuJIVSW]
por lo tanto, se genera un riesgo para la
WEPYHTFPMGE²TVIGMWE-LPI
(IIWXEQERIVEIPEKYE]PEIRIVKuEWSR
desafíos permanentes, considerando que
una gran parte del cobre sulfurado se
procesa en áreas desérticas. Esta situaGMzR WI LE IRJVIRXEHS GSR PE GSRWXVYGGMzRHIHIWEPEHSVEWSWILESTXEHSTSV
obtener el concentrado mediante proceWSWHI¾SXEGMzRIQTPIERHSEKYEHIQEV
“Ambas soluciones tienen en común la
necesidad de transportar el agua desde la
GSWXEEPEWTPERXEWHITVSGIWS² HMGI-LPI
pero advierte que el costo energético de
IWXESTIVEGMzRGSRWXMXY]IYRETEVXIWMKRM½GEXMZEHIPGSWXSHITVSHYGGMzRHIPGSRcentrado, “generándose un incentivo permanente para minimizar el uso de agua”.
Faenas e Instalaciones Mineras que exige, entre otras cosas, un plan de cierre
TEVE IP GSVVIGXS XqVQMRS ] QERINS HI
PSWHIWIGLSWQMRIVSW4EVEIWXSPEJEIRE
minera debe anticipar económicamente
al Estado una parte de su inversión, a
QSHSHIGIVXM½GEVIPTPERHIGMIVVIYRE
ZI^½REPM^EHEPEJEIRE
±)WXEVIKYPEGMzRLEHEHSLIVVEQMIRXEWE
7IVREKISQMRTEVEYRE½WGEPM^EGMzRQYGLS
más rigurosa que la permitida por la antiKYERSVQEXMZEPSUYILEPSKVEHSQINSVEV
el estándar de los depósitos actualmente
en operación”, indica Rodrigo Álvarez, diVIGXSV REGMSREP HIP 7IVZMGMS 2EGMSREP HI
+ISPSKuE]1MRIVuE7IVREKISQMR
'SRIP½RHIHMWTSRIVHIYR'EXEWXVS
2EGMSREPHI(ITzWMXSWHI6IPEZIWQjW
EGXYEPM^EHS ] XMP IWXI SVKERMWQS GVIz
en 2014 el Departamento de Depósitos de Relaves, con el propósito de
generar metodologías adecuadas en la
½WGEPM^EGMzRHIIWXITVSGIWSIMRGSVTSrar indicadores químicos de cada una de
estas estructuras.
±(IWHI PE IRXVEHE IR ZMKIRGME HI PE PI]
HITPERHIGMIVVI PEWIQTVIWEWLERMHS
GSQTVIRHMIRHSUYIXERXSPSWTVS]IGXSW
como la operación de estos depósitos,
deben apuntar al largo plazo en un cierre
acorde con los estándares ambientales
del país, como a una optimización de los
costos que este cierre tiene. Del costo
UYIIPGMIVVIWMKRM½GETEVEYREJEIREQMRIVE IP GSVVIWTSRHI EP GMIVVI HIP
depósito de relaves”, señala Álvarez.
)WEWuGSQSHYVERXIIP]PSUYIZE
de este año, personal del DepartamenXSHI(ITzWMXSWHI6IPEZIWLEIJIGXYEHS ZMWMXEW XqGRMGEW E PSW HITzWMXSW
catastrados con toma de muestra de
VIPEZIQEXIVMEPHIPQYVS]EKYEHIIWXI
proceso para recopilar información.
±(MGLEW ZMWMXEW LER TIVQMXMHS EPMQIRtar el Atlas online, además de permitir
caracterizar geoquímicamente el relaZI QYIWXVIEHS GSR IP ½R HI MHIRXM½GEV
elementos contaminantes o elementos
GSRZEPSVIGSRzQMGS%GXYEPQIRXIWILE
culminado la construcción de este Atlas
en donde se recopila la información de
XSHSWPSWHITzWMXSWHIVIPEZIWHI'LMPI
GEXEWXVEHSWEGXMZSWMREGXMZS]EFERHSREHSW²TVIGMWEIPHMVIGXSVHIPSVKERMWQS
Mejorando el estándar
Con el objetivo de realizar cambios
IJIGXMZSW IR QEXIVME HI ½WGEPM^EGMzR ]
seguridad, en el año 2012 entró en viKIRGME PE 0I] 2„ HI 'MIVVI HI
Innovación tecnológica
Frente a los permanentes desafíos que
plantean los depósitos de relaves, la inHYWXVMELEXVEFENEHSTEVEMRGSVTSVEVQjW
MRRSZEGMzR ] XIGRSPSKuE WMIQTVI GSR IP
SFNIXMZSHIHMWQMRYMVGSWXSW]PSKVEVYRE
QE]SVI½GMIRGMEIRPEKIWXMzRHIVIPEZIW
nme 66 marzo
MEDIO GESTION RELA 64-67.indd 66
07-03-16 17:46
“El desarrollo de equipos de gran capaGMHEH TEVE ½PXVEV VIPEZIW GSRWXMXY]I YRE
KVERMRRSZEGMzRUYITIVQMXMVjVIGYTIVEV
IPQj\MQSHIEKYETSWMFPIGSRYRQuRMQSHIIUYMTSWHI½PXVEHSIRSTIVEGMzR
TEVEXVEXEVKVERHIWXSRIPENIW]HITSWMXEV
PSWVIPEZIWIRJSVQEWIKYVE]ETXSWTEVE
YRETVSRXEVIGPEQEGMzR]JSVIWXEGMzRIR
PS TSWMFPI² HIWXEGE 7IVKMS 4VEHS 1MRIVEPW1EREKIVHIPEIQTVIWE*07QMHXL
8IRMIRHSIRGSRWMHIVEGMzRUYIIPEKYE
IW YR VIGYVWS IWGEWS TEVXMGYPEVQIRXI
IR PE ^SRE RSVXI HI 'LMPI PE QE\MQM^EGMzR HI PE VIGYTIVEGMzR HIP VIGYVWS LuHVMGS WI LE XVERWJSVQEHS IR YRE
TVMSVMHEHTEVEPSWSTIVEHSVIWQMRIVSW
)R IWXI GSRXI\XS E NYMGMS HI I\TIVXSW
PE EGXYEP STIVEGMzR QIHMERXI XVERUYIW
GSRZIRGMSREPIW TSHVuE WIV YRE XqGRMGE
HIPTEWEHSIRIPQIHMERSTPE^S
±0EXIRHIRGMESFZMEIWPEMRGSVTSVEGMzR
HIXIGRSPSKuEWUYISTXMQMGIRPEVIGYTIVEGMzR HIP VIGYVWS LuHVMGS XEPIW GSQS
IPIWTIWEQMIRXSEEPXEHIRWMHEHSTEWXE
]½PXVEHS)WXSWTVSGIWSWWIVjRPSWUYI
TVIHSQMRIRIRIPJYXYVSGIVGERS)WXEW
XIGRSPSKuEWRSWzPSTIVQMXIRSTXMQM^EV
PEVIGYTIVEGMzRHIEKYEWMRSUYIEHIQjW TIVQMXI STIVEV GSR XVERUYIW QYGLSWQjWIWXEFPIWKISQIGjRMGEQIRXI²
IRJEXM^E7IVKMS4VEHS
%GXYEPQIRXI LE] GSQTEyuEW QMRIVEW
UYIIZEPERPESTGMzRHI½PXVEVVIPEZIW
EKVERIWGEPEQMIRXVEWSXVEWLERSTXEHS
TSV XVEWPEHEV PSW VIPEZIW E PYKEVIW QjW
WIKYVSW±)WXSRSWMRHMGEUYIIRKIRIVEP
IWXEQSWIRTVIWIRGMEHIYRQERINSVEGMSREP]WYWXIRXEFPIHIPSWVIPEZIWIRIP
TEuW²EyEHI4VEHS
)WEWuGSQSEPSPEVKSHIPXMIQTSPEJSVQE
]XqGRMGEHIGSRWXVYGGMzRHIPSWHITzWMXSWLEMHSGEQFMERHSIMRGVIQIRXERHSIP
XEQEySHIIWXEWMRWXEPEGMSRIWIRPEKVER
QIHMERE ] TIUYIyE QMRIVuE 'SRWMHIVERHS PE MQTSVXERGME IGSRzQMGE UYI IP
GSFVIXMIRITEVEPEIGSRSQuEHIPTEuW IP
QERINS WIKYVS HI IWXI XMTS HI VIWMHYSW
WIKYMVjWMIRHSYRHIWEJuSGSRWXERXI
marzo 67 nme
MEDIO GESTION RELA 64-67.indd 67
07-03-16 17:46
Foto: Codelco
Desafío de la industria minera:
Hacia la reducción
del consumo del
recurso hídrico
Mejores prácticas en cuanto a eficiencia
hídrica y soluciones ambientalmente
sustentables, son parte de las iniciativas
para reducir el consumo de agua al
interior de los procesos mineros.
Paula Chapple
Agua utilizada en uno de los
procesos industriales de la
división El Teniente, de Codelco.
nm
nme
n
me
m
e6
688 ma
m
marzo
arrzo
rz
zo
zo
MEDIO EFICIENCIA 68-70indd.indd 68
07-03-16 17:46
)RWR0LQHUD(VFRQGLGD
$QLYHOUHJLRQDO$QWRIDJDVWDHVOD
UHJLyQFRQXQPD\RUFUHFLPLHQWRHQFDXGDO
GHFRQVXPRGHDJXDGHPDU(QODIRWROD
SODQWDGHVDOLQL]DGRUDGH0LQHUD(VFRQGLGD
XELFDGDHQ3XHUWR&RORVR$QWRIDJDVWD
E
l agua es considerada uno de los insumos estratégicos
para la minería del cobre, en especial dadas las crecientes restricciones que tiene su uso en un ambiente de menor disponibilidad y, por lo tanto, mayor costo de obtención.
Este escenario ha motivado diversas iniciativas dentro del rubro minero enfocadas en reducir los niveles de consumo del
recurso hídrico, hipótesis que se debatió en el marco de la
reciente versión de las VI Jornadas Económicas Chile-Alemania
2015, evento organizado por la Cámara Chileno-Alemana de
Comercio e Industria (Camchal).
Y es que según datos entregados por la Comisión Chilena
del Cobre (Cochilco), en su reciente estudio “Proyección del
consumo de agua en la minería del cobre al 2026”, se espera
una tendencia decreciente de un 1,9% anual desde lo estimado al 2015 para el consumo de agua fresca, mientras que
para el caso del agua de mar ésta sería creciente a una tasa
de 14,1% anual.
Es así como al año 2026, el consumo de agua fresca alcanzaría
los 10,8 m³/s (siendo un 87% proveniente de iniciativas base o
probable), lo cual casi se iguala al uso de agua de mar de 10,7
m³/s (con un 60% explicado por proyectos en condición base
o probable).
En tanto, a nivel regional, Antofagasta es la región con un mayor crecimiento en caudal de consumo de agua de mar, reduciendo consistentemente su participación de utilización nacional de agua fresca desde un 43% el 2015 a un 21% el 2026.
“La distribución del consumo de agua no es homogénea
en las regiones, hay una relación evidente entre una mayor
producción minera y un mayor consumo de agua, donde la
región de Antofagasta es la que consume mayor cantidad
de agua”, destaca José Tomás Morel, gerente de Estudios e
integrante de la Comisión de Recursos Hídricos del Consejo
Minero.
“Sin agua no hay minería”, agrega tajante, Morel. De esta manera, cobra especial relevancia el uso de agua de mar, debido
a que las proyecciones indican que hay un incremento del uso
del agua, principalmente de ésta al año 2026, que va casi a la
par con el consumo de agua proveniente de fuentes continentales.
“A nivel global, el uso de agua en su totalidad aumentará considerablemente porque Chile pretende seguir desarrollando su
producción de cobre. Asimismo, al enfrentar leyes de mineral
cada vez más bajas, se requerirá más agua”, agrega el representante del Consejo Minero.
(ÀFLHQFLDKtGULFD
Las cifras son claras. El consumo unitario de agua por tonelada
de cobre procesado ha ido bajando, tanto en el proceso de
concentración como en el proceso de hidrometalurgia. “Para
la minería esto es fundamental, ya que tenemos que tener conWYQSWHIEKYEGEHEZI^QjWI½GMIRXIWYXMPM^ERHSQIRSWEKYE
por tonelada de mineral procesado”, destaca Morel.
3XVSMRHMGEHSVHII½GMIRGMEIWPEVIGMVGYPEGMzRHIEKYE%PWYmar todas las regiones, el porcentaje de recirculación de agua
está en torno al 74%. “No es raro entonces pensar que las
regiones que están un poco más al sur tengan tasas de recirculación algo más bajas, porque el agua en esas regiones es
relativamente más abundante que en aquellas que son más
secas”, expresa el ejecutivo del Consejo Minero.
Otro factor vital es la relación con las comunidades aledañas. “No basta con decir que la industria minera utiliza sólo
el 5% de agua en las regiones donde opera, es natural que
IRJVIRXIQSW GSR¾MGXSW GSR PEW GSQYRMHEHIW GIVGEREW ] IWS
es un elemento que no podemos soslayar. Por eso la minería
sabe que tiene la obligación de hacer los mayores esfuerzos
por mitigar su impacto por el consumo de agua y entregar a
marzo 69 nme
MEDIO EFICIENCIA 68-70indd.indd 69
07-03-16 17:46
Foto: Sierra Gorda
tema trivial”, prosigue el experto del
Consejo Minero.
Respecto a los usos del agua en mineVuEWISFWIVZEUYIIPGSRWYQSTVMRGMTEP
está en planta, en el proceso de concentración, aunque también es importante
en el proceso de hidrometalurgia.
“También es imperativo la utilización del
agua en minas, para control de polvo,
para evitar la emisión de polvo en suspensión, y en campamentos, servicios,
GSRIWXSQIVI½IVSEUYIIPEKYEIRQMRIVuEIWMQTVIWGMRHMFPI 7MIPWIYWE
en concentración, podemos decir que sin
EKYERSLE]QMRIVuE²ETYRXE1SVIP
El caso de Sierra Gorda
La mina Sierra Gorda ha logrado
LQFRUSRUDUHVWiQGDUHVHÀFLHQWHV
al interior de sus procesos.
Desde la perspectiva del agua, el
proyecto, cuando se diseñó, se ideó
utilizando agua de mar.
la comunidad toda la información que
le permita saber cuánta agua está conWYQMIRHS]½REPQIRXIHMEPSKEVGSRPSW
vecinos”, añade Morel.
Restricciones
En términos de costos, el mismo estudio
de Cochilco arrojó que la utilización de
agua de mar desalada en operaciones
UYI GSRWYQIR PW WMKRM½GEVuE YR
costo de 16 cUS$/lb, con un rango entre 7 a 27 cUS$/lb en un escenario de
TVIGMSHIPEIRIVKuEHI971;L
“Respecto al uso de agua de mar, el
costo de usarla versus el costo de uso
de aguas continentales aparece como la
gran limitante. Comparando Chile con
SXVSW TEuWIW QMRIVSW GSQS %YWXVEPME
Canadá, México, Estados Unidos, entre
otros, se observa que el costo del sistema de desalinización (Capex y Opex),
IW WMQMPEV IRXVI PSW HMWXMRXSW TEuWIW IR
torno a US$ 1,4 por m³. En Chile es de
US$ 1,5. No obstante, las diferencias se
dan esencialmente por las alturas de los
yacimientos, las distancias en relación
al mar. En el caso de Chile, con faenas
ubicadas en promedio a 3.460 metros
HI EPXYVE² MRHMGE 1SVIP %Wu PE MRZIVWMzRIRGEyIVuEWHYGXSW]IWXEGMSRIWHI
bombeo para impulsar el agua de mar
al yacimiento, sumado al costo de enerKuEUYIMRZSPYGVEIWIMQTYPWS±RSIWYR
9RINIQTPSHIQMRIVuEWYWXIRXEFPIIWPE
operación Sierra Gorda. Ubicada a 150
OQ HI%RXSJEKEWXE ] E WzPS OQ HIP
pueblo de Sierra Gorda, pequeña localidad emplazada en el desierto, la minera
LE PSKVEHS MRGSVTSVEV IWXjRHEVIW I½cientes al interior de sus procesos.
Es el caso de la utilización de agua de mar
en la concentradora. “Iniciamos nuestra
operación en 2014, con muchas innovaciones y en particular con el uso de agua
HIQEV²HIWXEGE%RE>yMKE7ER^EREZMGITVIWMHIRXIHI%WYRXSW'SVTSVEXMZSW]
Sustentabilidad de Sierra Gorda.
Desde la perspectiva del agua, el proyecto, cuando se diseñó, se hizo utilizando agua salada, agua de mar.
“La particularidad es que esta agua la
obtenemos del sector de Mejillones. Es
un agua de descarte de una termoelécXVMGEYFMGEHEIRPEFELuEHI1INMPPSRIW]
que utiliza el agua de mar en su proceso
de enfriamiento. En vez de usar el reGYVWSLuHVMGS]HIZSPZIVPSEPQEV7MIVVE
Gorda lo captura y eleva hasta los 1.700
metros sobre el nivel del mar, que es
donde está nuestra faena, viajando del
orden de 140 km a través de un acueducto”, destaca la ejecutiva.
En el caso de Sierra Gorda, el agua de
mar es utilizada en forma directa, sin
desalinizar. Para el procesamiento del
molibdeno, la minera cuenta con una
planta de osmosis inversa, que desala
esa agua y que es utilizada en el proceso
de producción.
nme 70 marzo
MEDIO EFICIENCIA 68-70indd.indd 70
07-03-16 17:47
Avisos.indd 1
07-03-16 15:07
Foto: Minera Los Pelambres
Los constantes retos de la
gestión del agua en minería
Junto con encontrar soluciones para el siempre complejo tema de la
disponibilidad, las compañías también enfrentan desafíos hídricos
al interior de sus propias faenas, para optimizar el uso del agua y
aprovechar de mejor manera un recurso cada vez más escaso y preciado.
Joaquín Ruiz
L
os recursos hídricos siempre han sido un elemento clave
para la minería. Un insumo estratégico para la operación que muchas veces se torna en un factor crítico, especialmente para la
industria de Chile, asentada principalmente en paisajes áridos y
desérticos donde ya casi no quedan recursos frescos disponibles.
Este panorama ha impulsado a la industria a mirar cada vez
más al mar como fuente del recurso, aunque desalinizar y
bombear a las alturas donde normalmente se realiza minería
en Chile tampoco parece ser una tarea muy sencilla.
Junto con solucionar el tema de la disponibilidad, las compañías
también enfrentan retos hídricos al interior de sus propias faenas, para optimizar su uso y aprovechar de mejor manera un
recurso cada vez más escaso y preciado.
“Pese a los importantes esfuerzos realizados para reducir los
consumos de agua, que se han traducido en una importante
disminución del consumo unitario, expresado en litros de agua
por tonelada de mineral procesado, la constante disminución
de la ley media de los minerales procesados y el aumento
WSWXIRMHS HI PE TVSHYGGMzR WMKRM½GER YRE QE]SV HIQERHE
de agua para el sector”, explica Mauricio Gironás, gerente de
Plantas Concentradoras y Puerto en mineras Candelaria y
Ojos del Salado.
La sequía que ha enfrentado la zona centro-norte de Chile en
estos últimos años, y que de acuerdo a los especialistas podría
ser una señal de una tendencia a mediano y largo plazo, obliga
a las compañías a seguir con los esfuerzos para reducir la demanda y buscar fuentes alternativas y sustentables. Todo ello
en un contexto complejo de bajos precios de los metales y de
imperiosa necesidad de elevar los niveles de productividad y
reducción de los costos de producción.
nme 72 marzo
MEDIO GESTION AGUA 72-73.indd 72
07-03-16 17:46
Desalinización
En su último informe de proyección de
la demanda de agua en la minería, publiGEHSE½REPIWHIPEySTEWEHS'SGLMPGS
pronostica por primera vez una disminución de hasta 19% de aquí a 2030 de
la demanda de agua fresca por parte de
la industria minera. Una cifra que se explica principalmente por el crecimiento
importante del uso de agua de mar, desalinizada o no, en el sector. Para Gironás, estas
cifras demuestran que la tendencia llegó
para quedarse.
“La mayoría de los nuevos proyectos
mineros considera el agua de mar como
fuente de abastecimiento. Esto plantea
importantes desafíos en términos de
costos, debido a la fuerte inversión que
requieren estos proyectos y al alto consumo energético, no sólo para desalinizar,
sino sobre todo para bombear el agua
desde el borde costero hasta la faena
minera”, precisa.
Sin embargo, el ejecutivo reconoce que
si bien el agua de mar es una fuente
segura e inagotable, no es necesariamente la mejor solución para todos los
proyectos. En este sentido, asegura que
es fundamental analizar el problema de
suministro de agua en un contexto regional, buscando posibles sinergias que
permitirían reducir los costos, aportando soluciones no solo para la minería
sino también para otros sectores.
Foto: Archivo personal
Mauricio Gironás
Adicionalmente, las comunidades y su
cada vez más activa participación en
denuncias y movilizaciones en contra
de grandes proyectos es otro factor
que han tenido que tomar en cuenta las
compañías que pretenden desarrollar
iniciativas que inevitablemente generan
impacto en su entorno.
±6IWYPXE JYRHEQIRXEP KIRIVEV GSR½ERza en la comunidad a través de mayor
transparencia y participación”, reconoce
Gironás, aunque aclara que existen “muchos mitos” en relación a los efectos
reales de la minería en la disponibilidad
y calidad de los recursos hídricos.
“La actual escasez de agua en algunos
sectores no puede ser imputada solamente a la industria minera, ya que es
el resultado de un conjunto de factores,
entre los cuales están el sobreconsumo
]YWSTSGSI½GMIRXITSVTEVXIHISXVSW
sectores, como por ejemplo la agricultura y otras actividades industriales y domiciliarias, sin dejar de lado los efectos
que produce a nivel global el cambio
climático”, enfatiza Gironás.
El ejecutivo, que encabezará la organización de un congreso internacional sobre
gestión del agua en mayo próximo (ver
recuadro), asegura que la industria minera ha asumido desde hace “muchos
años” un “claro liderazgo” en la gestión
de los recursos hídricos.
“En la mayor parte de las faenas mineras
se lleva una verdadera contabilidad de
EKYEUYITIVQMXIMHIRXM½GEVPSWGSRWYQSW
efectivos y priorizar las medidas que aseKYVERYRYWSI½GMIRXIHIPVIGYVWS²EKVIga el gerente de Plantas Concentradoras
y Puerto de Candelaria y Ojos del Salado.
Pero también es necesario avanzar en la
caracterización en línea de los diferentes
¾YNSWHIEKYEEPSPEVKSHIXSHEPEGEHIna de procesos, reconoce el experto. “Un
mayor control de la calidad del agua de
proceso es fundamental para garantizar la
I½GMIRGMEHIPSWTVSGIWSW]TEVEPSKVEVYR
YWSQjWI½GMIRXIHIPVIGYVWS²HIWXEGE
Mauricio Gironás, gerente de
Plantas Concentradoras y Puerto en
mineras Candelaria y Ojos del Salado.
Water in Mining
Con el foco en la gestión innovadora, económica y sustentable del
agua en minería se realizará, entre el 18 y 20 de mayo, la quinta versión del Congreso Internacional en Gestión del Agua en la Minería,
Water in Mining 2016.
Para este año, los organizadores esperan más de 300 participantes
que asistirán a las más de 40 presentaciones técnicas y 6 conferencias plenarias que contempla el programa. Hasta el cierre de esta edición, ya han recibido más de 80 resúmenes de autores provenientes
de 15 países.
Como en las versiones anteriores, el evento está organizado en conjunto por el Centro para el Agua en la Industria de los Minerales del
Sustainable Minerals Institute de la Universidad de Queensland, Australia, y el Instituto Nacional de Ciencia y Tecnología en Recursos
Minerales, Agua y Biodiversidad, INCT-Acqua de Brasil, además de la
empresa Gecamin.
marzo 73 nme
MEDIO GESTION AGUA 72-73.indd 73
08-03-16 16:39
Multas ambientales del SMA
alcanzaron US$ 43,9 millones en 2015
Luego de tres años de funcionamiento, la Superintendencia de Medio
Ambiente (SMA) ha ido incrementando el número de multas de
manera categórica. Esto se evidenció el año pasado, al iniciar más de
140 procesos sancionatorios y emitir multas por US$43,9 millones,
IUYMZEPIRXIWEQjWHI98%
Para la institución, esta es una cifra récord, al superar las 100 multas
WERGMSREXSVMEWUYIIWXEMRWXMXYGMzRIQMXMzIRGYERHSEPGER^zPSW97QMPPSRIWIRQYPXEWEQFMIRXEPIW
Esto se explica, en parte, por un crecimiento del 30% en los procesos iniciados: durante el año pasado la entidad
TYWSIRQEVGLETVSGIWSWQjWUYIIR]QjWHIPSWERSXEHSWIR
(IEGYIVHSEPVIKMWXVSHIP71%PEQMRIVuEWIEHNYHMGzIPHIPEWQYPXEWWIKYMHSTSVIRIVKuEI
MRJVEIWXVYGXYVEHIXVERWTSVXI
Realizarán sumario sanitario por derrame
de concentrado de cobre en Codelco
0YIKSHIUYIIPTEWEHSHIJIFVIVS'SHIPGSMRJSVQEVEWSFVIIPHIVVEQIHIGSRGIRXVEHSHIGSFVIVIKMWXVEHSIR
las faenas de la División Andina, en Los Andes (Región de Valparaíso), la seremi de Salud de la Provincia de AconcaKYEMRJSVQzUYIMRMGMEVjYRWYQEVMSWERMXEVMSTEVEIWXEFPIGIVPEWVIWTSRWEFMPMHEHIWHIPEIQTVIWEIRPEIQIVKIRGME
±,IQSWVIWYIPXSQERHEVYRIUYMTSHI½WGEPM^EHSVIWTEVELEGIVPEWETVS\MQEGMSRIWEPEWMXYEGMzRUYIIWXjSGYVVMIRHSTVSHYGXSHIIWXEGSRXEQMREGMzR²MRHMGzIPNIJIHIPE3½GMRE4VSZMRGMEPHI%GSRGEKYEHIPE7IVIQMHI7EPYH
1EVMS1qRHI^EPYHMIRHSEPGSRGIRXVEHSHIQMRIVEPUYIJYIHIVVEQEHSEP6uS&PERGSIRIPWIGXSVHI7EPEHMPPS
%WMQMWQSPEEYXSVMHEHMRHMGzUYIWILERXSQEHSTVYIFEWEPEKYEHIPVuSTEVETSHIVGSVVSFSVEVPEWMXYEGMzRHI
GSRXEQMREGMzRVIWTIGXSHIPSWQIXEPIWUYITYHMIVERIWXEVTVIWIRXIWIRIPEKYE
Investigación alerta sobre los peligros
de salinización de agua de los ríos
Las actividades humanas como la agricultura o la extracción de recursos (carbón, minerales
o gas) están aumentando la salinidad del agua, causando efectos adversos para la salud
LYQERE]IPJYRGMSREQMIRXSHIPSWIGSWMWXIQEW%WuPSGSR½VQzYRIUYMTSHIMRZIWXMgadores de la Universidad de Barcelona (UB).
“Es importante considerar soluciones y políticas preventivas globales surgidas del conWIRWSGMIRXu½GS]UYIXIRKERIRGYIRXEPSWIJIGXSWWSGMEPIWIGSRzQMGSW]QIHMSEQbientales para proteger los ecosistemas acuáticos de la salinización y garantizar el
EGGIWS HI KIRIVEGMSRIW JYXYVEW E PSW FMIRIW ] WIVZMGMSW UYI IWXSW IGSWMWXIQEW RSW
proporcionan”, precisa la investigación.
0SWGMIRXu½GSWLERHIWXEGEHSUYIHMJIVIRXIWMSRIWXMIRIRXS\MGMHEH]TSVIPPSVIGPEQER
YRE PIKMWPEGMzR IWTIGu½GE TEVE VIKYPEV PSW PuQMXIW HI GSRGIRXVEGMzR HI GEHE MSR GPSVYVS
magnesio, sodio, entre otros) en ríos y lagos a nivel mundial.
nme
74
marzo
BREVES MEDIO 74.indd 74
07-03-16 17:52
Avisos.indd 1
07-03-16 15:07
Imagen: Breeam
Innovación, I+D y transferencia tecnológica
Las claves
para el desarrollo sustentable
¿Por qué la transición hacia el desarrollo demora tanto? Explicaciones hay
muchas; recetas, ninguna. Sin embargo, expertos creen que la inversión en
I+D y la transferencia tecnológica son claves para convertir a Chile en un
país innovador, el camino seguro hacia el desarrollo.
Nicolás Rojas
Desde Antofagasta
nme 76 ma
marzo
arrzo
zo
z
INNOVA 76-81.indd 76
07-03-16 17:47
D
urante el segundo semestre de
2011, los profesores Ricardo Hausmann
y César Hidalgo, de la Universidad de
Harvard y el Instituto Tecnológico de
Massachusetts (MIT), respectivamente,
publicaron el Atlas de Complejidad Económica (atlas.media.mit.edu/). Este ranking mide la complejidad de producción
y la diversidad de productos que exportan los países, haciendo una correlación
-para muchos imperfecta- entre complejidad económica y crecimiento del
PIB per cápita.
Imperfecta porque el PIB per cápita de
Chile indicaría que nuestro lugar en el
ranking debiese ser bastante mejor que
el 67° que ostentamos. ¿La explicación
de este fenómeno? Minería y agricultura, principalmente, donde Chile muestra
importantes ventajas comparativas.
Ahora, ¿cómo mejoramos nuestra complejidad económica? Según los expertos
la respuesta es fácil: innovación.
Todos quieren ser como ellos
Todos saben hacia dónde queremos
llegar. El problema es que nadie tiene la
receta. Generalmente a los países que
han logrado el desarrollo económico
WI PIW TSRI IP GEPM½GEXMZS HI±QMPEKVS²
Imagen: Peter Joseph James
Actualmente sólo un 5% de las
empresas en Chile cuenta con desarrollo
experimental, 1,3% contrata personal
FDOLÀFDGRSDUDLQYHVWLJDU\HOWLHQH
un laboratorio o departamento
GHLQYHVWLJDFLyQGHDFXHUGRDGDWRV
del Ministerio de Economía.
S±JIRzQIRS²%WuIWGYGLEVLEFPEVHIP
±JIRzQIRS HI 'SVIE HIP 7YV² ] HIP
±QMPEKVS HI 2YIZE >IPERHME² IW QY]
común, pero el problema, además de
lo odiosas que son las comparaciones,
es que sus recetas no son imitables: diferentes culturas, situaciones históricas,
población, recursos naturales y un largo etcétera hacen que sea imposible
seguir al pie de la letra sus consejos.
Sin embargo, a pesar de esas distancias,
hay algunos aspectos que debiésemos
tener en consideración.
Para el director del Departamento de
Economía de la Universidad Católica del
2SVXI9'21MKYIP%XMIR^EWMMRWMWXMQSWIREREPM^EVIWXSW±QMPEKVSW²IPGEWS
de Corea se asemeja más al de Chile.
±% ½RIW HI PSW EySW IWI TEuW XIRuE
un nivel de desarrollo menor que Latinoamérica. Lo que ocurrió ahí fue una
apuesta del Estado por el desarrollo industrial, pero una apuesta distinta a la
que ocurrió en Chile (y gran parte de
%QqVMGE HIP 7YV IRXVI PSW EySW ]
70, que fue lo que se llamó la ‘industriaPM^EGMzR TSV WYWXMXYGMzR HI MQTSVXEGMSnes’. Es decir, nos cerramos y creamos
YREMRHYWXVMEMRXIVREUYIWIEGETE^HI
proveer al mercado nacional y luego,
no sabemos cómo, exportar. En Corea
hicieron algo muy distinto: apostaron
por hacer una industria exportadora, la
protegieron pero ayudándola a crecer
LEGME EJYIVE² I\TPMGE IP EGEHqQMGS HI
PE9'2
¿Cuál es el resultado? El mismo ranking
de complejidad económica sitúa a Corea del Sur en la séptima posición y su
4-&TIVGjTMXEWYTIVEPSW97
Pero en realidad, según la mirada de los
expertos consultados, esto no es ningún
milagro. Además del impulso del Estado
para abrir la economía, ha habido una
constante preocupación por invertir
en Investigación y Desarrollo (I+D).
De acuerdo a datos de la OCDE, desTYqWHI-WVEIPHIP4-&'SVIEIW
el país que más invierte en este ítem
HIP4-&
¡='LMPI#7IIRGYIRXVEEP½REPHIPEPMWXEKVEGMEWEUYIMRZMIVXIWzPSYR
HIP4-&GMJVEUYIIRYRVIWTSRHI
al aporte estatal, de acuerdo a datos entregados por Patricio Feres, gerente de
Innovación de Corfo.
¿Cómo andamos por casa?
De acuerdo a la tercera encuesta longitudinal de empresas para medir la
marzo 77 nme
INNOVA 76-81.indd 77
08-03-16 14:42
En la misma línea, Kenneth Gent, gerente General de la consultora Momento
Cero, suma otro factor: la falta de visión
estratégica.
“Si compramos maquinaria, software y
una serie de elementos para la minería,
si somos el país que más cobre extrae,
si tenemos a todas las empresas grandes acá en nuestro país; entonces ¿por
qué no agregamos valor en serio? Ahí
echo de menos la visión estratégica de
meternos en los negocios buenos, incorporar conocimiento y ventajas competitivas, venderle minería al mundo”,
destaca Gent.
Las preguntas correctas
Albert Einstein dijo: “Si tuviera que resolver un problema en una hora y mi
vida dependiera de ello, dedicaría 55 minutos a encontrar la pregunta adecuada,
y los cinco restantes a la respuesta”.
Si bien hace varios años en Chile existe
preocupación por la baja inversión en
I+D, desde Corfo señalan que el camino que ha tomado el país va en la línea
correcta.
De acuerdo a Patricio Feres, la experiencia internacional señala que
en países con bajo nivel de inversión
empresarial en I+D, los mecanismos
de incentivo tributario en complemento con los subsidios públicos,
contribuyen a que las empresas se
decidan a inver tir en I+D, generando
un círculo vir tuoso.
“En la medida de que éstas observan
el impacto de la I+D en la empresa, se
valora y se instala el concepto para que
llegue a formar parte de la estrategia
empresarial, instalándose en el ADN
como una actividad de carácter sisteQjXMGS²E½VQE*IVIW
Es que no es extraño, para el nivel de
desarrollo de Chile, que la mayoría de
esta inversión provenga desde el Estado.
De acuerdo al profesor Atienza, todo
indica que a medida de que los países
se desarrollan, esta tendencia, naturalmente, comienza a revertirse.
El problema es saber si realmente estamos haciéndonos las preguntas correctas, pues, tal como señala el gerente
Foto: Nicolás Rojas
Investigación y Desarrollo en Chile,
realizada por el Ministerio de Economía en 2015, sólo un 5% de las empresas cuenta con desarrollo experimental (referente al trabajo creativo
para incrementar el conocimiento y
su uso para crear nuevas aplicaciones),
GSRXVEXETIVWSREPGEPM½GEHSTEVE
investigar y el 1% de las compañías en
Chile tiene un laboratorio o depar tamento de investigación.
Del informe, publicado en noviembre
del año pasado, se deduce una importante correlación entre el tamaño de la
empresa, su antigüedad (las empresas
entre 11 y 20 años son las que más invierten) y su inversión en el tema en
cuestión.
De esta forma, si analizamos solo a las
empresas grandes, el 20,7% invierte en
desarrollo experimental, más del 8%
GSRXVEXETIVWSREPGEPM½GEHSTEVEMRZIWtigar y más del 10% tiene laboratorio de
investigación.
“El problema es que, en general, esa inversión no la realizan empresas chilenas,
sino transnacionales localizadas en Chile”, complementa el doctor en Economía, Miguel Atienza.
Es que, al parecer, no basta con las leyes de incentivo tributario vigentes desde hace varios años en Chile. También
existe un problema cultural del que la
educación debe hacerse cargo, además
de otros factores que desincentivan la
innovación.
“En lo personal, creo que hay tres facXSVIWUYIMR¾Y]IRHMVIGXEQIRXIIRIWXE
situación: somos una economía muy
abierta al mundo, entonces en el corto
plazo es más rentable vender recursos
naturales que inventar algo desde cero,
por lo que no existe mucho incentivo.
Es más fácil comercializar que crear. En
segundo lugar, tenemos una masa crítica pequeña, solo somos 17 millones de
habitantes. Y por último, hay una falta
HIGYPXYVEHIGVIEGMzRRSLE]WY½GMIRte cultura de propiedad intelectual, de
patentar”, asegura Hernán Conejeros,
gerente técnico de Minería de 3M, empresa que ha destacado precisamente
por su innovación.
“A fines de los años 40, Corea tenía
un nivel de desarrollo menor que
Latinoamérica. Lo que ocurrió ahí
fue una apuesta del Estado por el
desarrollo industrial, distinto a lo que
ocurrió en Chile (…) En Corea apostaron
por hacer una industria exportadora”.
Miguel Atienza, director del Departamento
de Economía de la UCN.
nme 78 marzo
INNOVA 76-81.indd 78
08-03-16 14:42
Avisos.indd 1
07-03-16 15:07
Foto: Momento Cero
Foto: 3M
Foto: Corfo
“En países con bajo nivel de
inversión empresarial en I+D, los
mecanismos de incentivo tributario
en complemento con los subsidios
públicos, contribuyen a que las empresas
se decidan a invertir en I+D, generando
un círculo virtuoso”.
“Somos una economía muy abierta
al mundo, entonces en el corto plazo
es más rentable vender recursos
naturales que inventar algo desde
cero, por lo que no existe mucho
incentivo. Es más fácil comercializar
que crear”.
“En materia minera, debemos mirar a
los que venden minería y no minerales:
Suecia y Finlandia, por ejemplo.
¿Cómo lo hicieron? Vinculando
a las universidades, los fondos de
capital de riesgo, el Estado y las
empresas”.
Patricio Feres,
gerente de Innovación de Corfo.
Hernán Conejeros,
gerente Técnico de Minería de 3M.
Kenneth Gent,
gerente general consultora Momento Cero.
de Innovación de Corfo, la inversión en
-(RSIWYR½RIRWuQMWQS
Kenneth Gent, quien tiene vasta expeVMIRGME IR MRRSZEGMzR WY IQTVIWE MRvierte en I+D entre un 10 y un 15% de
PEWZIRXEWGVIIUYIIRIWXEQEXIVMERS
IWXEQSWLEGMqRHSRSWPEWTVIKYRXEWUYI
GSVVIWTSRHIR
±8SHEZuERSIWTSWMFPIHIQSWXVEVUYI
el esfuerzo de innovación de los úlXMQSW HMI^ EySW IR IP WIGXSV QMRIVS
LE]E MQTEGXEHS IR YR TYRXS HIP 4-&
IR XqVQMRSW HI GVIEGMzR HI ZEPSV
7IKYMQSW ZIRHMIRHS QMRIVEPIW ] RS
QMRIVuE 0E TVIKYRXE UYI HIFIQSW
LEGIVRSW IW GzQS ZEQSW E MQTEGtar creando valor en uno, dos o tres
TYRXSW HIP 4-& IR PSW TVz\MQSW HMI^
EySW=SNSUYIIR'LMPIPSLIQSWLIGLS FEWXE GSR QMVEV IP HIWEVVSPPS HI
PE MRHYWXVME HIP WEPQzR IR IP WYV YR
XVEFENS QERGSQYREHS IRXVI IP )WXEHS]*YRHEGMzR'LMPI¡4SVUYqWILM^S
FMIR#4SVUYIWILMGMIVSRPEWTVIKYRXEW
GSVVIGXEW²HMGI+IRX
)P I\TIVXS HI PE GSRWYPXSVE 1SQIRXS 'IVS EyEHI UYI IR QEXIVME QMRIVE 'LMPI HIFI QMVEV E PSW UYI ZIRHIR
QMRIVuE ] RS QMRIVEPIW GSQS 7YIGME ]
*MRPERHMETSVINIQTPS
±¡'zQS PS LMGMIVSR# :MRGYPERHS E PEW
universidades, los fondos de capital de
VMIWKS IP )WXEHS ] PEW IQTVIWEW )WXI
IW IP XMTS HI GYIWXMSRIW UYI HIFIQSW
TPERXIEV²VI¾I\MSRE
UYIPPIKEREPEIQTVIWETVMZEHEEHIWEVVSPPEVEPKRXMTSHIMRZIWXMKEGMzRSHIWEVVSPPS7SPSIPHIPEWGSQTEyuEW
contrata a este tipo de personal para
HMGLSW½RIW
)RVIPEGMzREIPPS4EXVMGMS*IVIWWSWXMIne que todo el esfuerzo que se pueda
LEGIVHIWHIIP)WXEHSHIFIWIVGSQTPIQIRXEHSGSRPETSPuXMGEHIPEWIQTVIWEW
¡'zQS PS LEGIR PSW UYI WEFIR# ,IVRjR 'SRINIVSW I\TPMGE UYI IRXVI PSW
HMJIVIRXIW MRHMGEHSVIW UYI XMIRI 1
uno de ellos tiene que ver con la reinZIRGMzRTYIWEPVIHIHSVHIYRHI
PEWZIRXEWHIPEGSQTEyuEHIFIGSVVIWTSRHIV E TVSHYGXSW RYIZSW 4IVS QjW
MQTSVXERXIUYIPEWQqXVMGEW'SRINIVSW
destaca la cultura interna, donde no se
GEWXMKEIPIVVSV)WXSPXMQSUYIWITYIHIWYTSRIVSFZMSGYEPUYMIVQERYEPHI
MRRSZEGMzRRSWHMVjIWSIWPSQjWHMJuGMP
4IVSQjWEPPjHIPSUYIIP)WXEHSTYIHEVIEPM^EV]PSWGEQFMSWRIGIWEVMSWIR
PE GYPXYVE SVKERM^EGMSREP LE] YR XIVGIV
TYRXS UYM^jW ER QjW GSQTPMGEHS PE
XVERWJIVIRGMEXIGRSPzKMGE
De acuerdo a los expertos, los proveeHSVIW GLMPIRSW HI PE QMRIVuE RS XMIRIR
WY½GMIRXIRMZIPHIHIWEVVSPPSXIGRSPzKMGSTEVEWIVGSQTIXMXMZSWTSVPSGYEPIW
Las claves para el desarrollo
8ERXS IP GEWS HI 'SVIE GSQS SXVSW
INIQTPSW E RMZIP MRXIVREGMSREP WSR QMVEHSWTSVUYMIRIWIPEFSVERPEWTSPuXMGEW
TFPMGEWHI'LMPIGSRIP½RHIGSQTVIRHIV GzQS LER EZER^EHS LEGME IP HIWEVVSPPS )R IWI GSRXI\XS HIWHI 'SVJS
EGPEVER UYI ±LE] WY½GMIRXI IZMHIRGME
IQTuVMGE UYI RSW TIVQMXI IWXEFPIGIV
UYITEVEIGSRSQuEWGSQSPEGLMPIREPE
MRZIVWMzRIRGETMXEPLYQERSEZER^EHS]
IR-(TVMRGMTEPQIRXIIQTVIWEVMEPVIsulta clave, las cuales están consideradas
IR PE%KIRHE HI TVSHYGXMZMHEH ] GSQTIXMXMZMHEH²
(I IWXE JSVQE HMZIVWEW MRWXMXYGMSRIW
IWXEXEPIW GSQS 'SVJS ] 'SRMG]X IRXVI
SXVEWLERIPEFSVEHSFIRI½GMSWGSQTPIQIRXEVMSW TEVE JSVQEV GETMXEP LYQERS
avanzado y que estos expertos no sólo
PPIKYIREPEWYRMZIVWMHEHIWWMRSXEQFMqR
EPEWIQTVIWEW
%GXYEPQIRXIWSRQY]TSGSWPSWTVSJIWMSREPIWGSRKVEHSHIHSGXSVSQEKuWXIV
nme 80 marzo
INNOVA 76-81.indd 80
07-03-16 17:47
fundamental “convencer a las grandes
transnacionales que operan acá para
UYIXVERW½IVERGSRSGMQMIRXSEPEWIQpresas chilenas”, dice Miguel Atienza.
“Esto es algo que tiene que surgir desde
acuerdos, porque normalmente una gran
empresa, si encuentra un proveedor chileno, le pedirá algo en particular, con una
serie de condiciones, pero no va a entrar
en una relación de colaboración ni transferencia, cuando eso es lo que necesitamos”, agrega el académico de la UCN.
Kenneth Gent, de Momento Cero, va
más al grano: “¿Por qué no sinceramos
cuánto están gastando las empresas mineras en I+D? ¿Cómo no nos da vergüenza que ése no sea un indicador
de RSE? Porque una minera que ocupa
un recurso no renovable puede hacer
RSE mirada desde la caridad o mirada
desde el desarrollo futuro. Para que la
conversa sea en serio, entonces que sea
en términos de inventar la industria del
futuro”, concluye.
La innovación en cifras
68%
4,6%
inversión en I+D que proviene del Estado, en Chile.
porcentaje de las empresas con menos de tres años y medio que usa
nuevas tecnologías o nuevos procesos en sus negocios.
$ 60.000
millones
suma total de beneficios tributarios aplicados durante 2015 para
proyectos de I+D.
67°
lugar de Chile en el último ranking de complejidad económica (2013),
29 puestos más abajo que en la misma medición de 1964 (38°).
Fuente: Corfo y Global Entrepreneurship Monitor 2014
marzo 81 nme
INNOVA 76-81.indd 81
07-03-16 17:47
Foto: Codelco
Súper conductor, transportando
mayor energía
El súper conductor eléctrico, que va entre la subestación Sauzal hasta Mineros
dentro de la División El Teniente de Codelco, busca transportar mayor energía.
Con este proyecto además, se aumenta la capacidad de la línea, que puede
soportar la ampliación de los futuros proyectos de la División.
Daniela Tapia
C
onducir un 40% más de energía y, a su vez, reducir pérdidas de energía en casi un 13% es el objetivo del súper conductor eléctrico Copper Alloy Conductor, CAC, por su sigla
en inglés, que instaló Codelco junto a la empresa española
LaFarga, dentro de la División El Teniente.
Cerca de 15 toneladas de cobre se utilizaron para la línea
eléctrica de 4,5 kilómetros de longitud, que por su capacidad
hidrofóbica del recubrimiento, no permite la acumulación de
nieve, problema recurrente en zonas donde el invierno puede
ser especialmente crudo, como sucede en la alta montaña.
El súper conductor CAC tiene una vida útil estimada de 40
años, cuya mayor virtud apunta a aumentar la capacidad de la
línea, soportando así la ampliación de los futuros proyectos de
la División El Teniente.
=IWUYIENYMGMSHI:uGXSV4IVI^KIVIRXIHI4PERM½GEGMzR'Smercial y Desarrollo de Mercados de Codelco, esta innovación
apunta al reposicionamiento de los conductores de cobre en
el mercado eléctrico.
“Este es el primer recambio de aluminio a cobre que ocurre
IRIWXIQIVGEHS]WMRHYHEXVEIVjGYERXMSWSWFIRI½GMSWEqWXE
y otras localidades de Chile y el mundo”, dice.
Con esta tecnología, que será comercializada a nivel mundial, la empresa española LaFarga busca repotenciar las líneas de alta tensión.
Sus ventajas
En medio de su cruzada para reducir costos ante los deprimidos precios globales de algunos commodities, la innoZEGMzR TEVIGI WIV PE TVMSVMHEH HI PEW ½VQEW QMRIVEW TEVE
El conductor cuenta con un recubrimiento
polimérico que mejora la protección contra
la corrosión y repele la formación de hielo.
nme
nm
n
me
m
e 82
82 m
ma
marzo
arzo
rrz
zo
zo
INNVA CONDU 82-83.indd 82
08-03-16 16:00
lleranas, como en la que se encuentra
ubicada la División El Teniente.
Actualmente, los cables son propensos a formar capas de hielo, generando un problema conocido como “Ice
Jumping”. Al formarse estas capas, hay
un aumento de peso en el conductor,
lo que provoca que se desestabilice, y
cuando se inicia el proceso de derretimiento, genera la caída del hielo y el
eventual choque entre cables, provocando cor tes de energía eléctrica, que
en el caso de la minería impiden la
continuidad de los equipos de procesamiento de minerales, lo que supone
pérdidas económicas.
De hecho, en el último frente de mal
tiempo que vivió la zona central en octubre del año pasado, se evidenciaron
en terreno tanto los efectos como las
diferencias entre el CAC y el conductor
de aluminio, “demostrando así el inmenWS FIRI½GMS UYI KIRIVE IWXI GSRHYGXSV² WIKR E½VQE PE TVSTME GSQTEyuE
minera.
Foto: Codelco
sor tear la tormenta. Y así lo ha hecho
Codelco.
Es por esto que bien vale la pena preguntarse en qué consiste y cuáles son las
ventajas de esta última innovación, que
busca una mayor productividad de la faena. En términos prácticos, la tecnología
del conductor consiste en un cable de
cobre, aleado con algunos materiales en
concentraciones muy bajas de no más de
un 4%, que logran una mayor conductividad y más resistencia mecánica que un
conductor de cobre puro, y mucho más
que un conductor de aluminio.
A su vez, el conductor cuenta con un
recubrimiento polimérico que atenúa el
zumbido (corona audible) y los chispazos (corona visible) que se pueden ver
y escuchar en una línea eléctrica, lo que
disminuye las pérdidas de energía.
Este recubrimiento también mejora la
protección contra la corrosión y repele
la formación de hielo. Esta última propiedad es la que evitará problemas de
corte o cortocircuitos en zonas cordi-
El súper conductor CAC tiene una
vida útil estimada de 40 años, cuya
mayor virtud apunta a aumentar
la capacidad de la línea, soportando
así la ampliación de los futuros
proyectos de la División El Teniente.
marzo 83 nme
INNVA CONDU 82-83.indd 83
08-03-16 16:00
Imagen: Maquetas Virtuales
Ingeniería de Minas en la Universidad de Talca:
Minería en zona agropecuaria
¿Una escuela de minería en la región del Maule? Parece extraño, pero
existe. Y no sólo ha crecido en sus tres años de funcionamiento, sino que
apuesta a posicionarse como un referente de enseñanza minera a nivel
país, en medio de una zona agropecuaria y lejos del norte grande.
Rodrigo López
E
l entorno natural de la región del Maule muestra principalmente plantaciones y cultivos de diverso tipo, bosques,
campos con animales, y unos cuantos ríos y lagos de cierta
importancia. Un paisaje característico de una zona eminentemente campestre, y a tono con sus principales actividades
económicas: forestal, agrícola, ganadera y generación eléctrica.
nme 84 ma
m
marzo
arzo
rz
zo
z
o
UNIV UTAL 84-85.indd 84
En efecto, el Maule concentra la mayor cantidad de hectáreas destinadas a frutales del país (cerca de 48.000, un
18% del total nacional), además de una intensiva industria
procesadora de madera y celulosa, y en el caso de la energía, siete plantas de generación eléctrica, tanto hidroeléctricas como termoeléctricas, las que en conjunto tienen
Proyección digital de la nueva sede de Ingeniería
Civil de Minas, de la Universidad de Talca.
08-03-16 16:01
XIQjXMGE ] JuWMGE HYVE GjPGYPS jPKIFVE
introducción a la ingeniería de minas),
mientras que en segundo año se imparte geología general. Recién en el VI semestre (3er año), los alumnos tienen los
ramos mineros (geoestadística, depósitos minerales, procesamiento de minerales y fundamentos de metalurgia).
“Nuestros alumnos se meten de lleno en ramos específicos de la especialidad, geología estructural, carguío
de transpor te, tronadura, etc. Nosotros vamos de lleno a la formación de
MRKIRMIVSWHIQMREW²HIWXEGE+SR^jlez, quien asumió la dirección de la
carrera hace sólo cuatro meses.
6IWTIGXS E PEW TVjGXMGEW PE QEPPE GYVVMcular contempla la realización de una
±TVjGXMGESFVIVE²IRWIKYRHSEyS]YRE
±TVjGXMGETVSJIWMSREP²IRGYEVXS]UYMRto año de la carrera. “Queremos que
ZE]EREPQj\MQSHIPYKEVIWETIVJIGGMSnarse”, agrega el director.
La situación de la minería regional
Las universidades de Santiago y el
nor te tienen puntos a favor a la hora
HIIWXYHMEVQMRIVuE%PIWXEVQjWGIVGE
de las principales faenas mineras del
mundo, a los estudiantes les resulta
QjWTVjGXMGSETVIRHIV]EGXYEPM^EVWYW
conocimientos.
Precisamente este es uno de los grandes desafíos pendientes de la Universidad de Talca: formar profesionales
de excelencia en medio de una gran
competencia con otros planteles, muGLSWHIIPPSWQINSVYFMGEHSWKISKVj½GEQIRXI
“Este proyecto se gesta porque tenemos una pequeña minería en la región y
le estamos dando a nuestra carrera un
plus diferente respecto de otras universidades especializadas en la exploración
SIRSXVEWjVIEW²TYRXYEPM^E+SR^jPI^
El director asegura que la Utal pretende
darle un “plus” a la carrera en materia
de sustentabilidad y medio ambiente. “Y
ése es nuestro enfoque hacia nuestros
ingenieros civiles de minas, con conociQMIRXSWHIQIGjRMGE²EyEHIIPEGEHqmico.
Si bien, es un hecho que el Maule es un
EGXSVQIRSVHIRXVSHIPjQFMXSQMRIVS
REGMSREPPEEGXMZMHEHIWXjQjWTVIWIRXI
Foto: Archivo personal Pablo González
una capacidad de producir, aproximadamente, unos 4.952,3 GWh, lo que la
convier te en la primera región generadora de electricidad del país.
Por eso, parece extraño que en una
zona principalmente silvoagropecuaria,
la Universidad de Talca (Utal) haya decidido impulsar la carrera de ingeniería
civil de minas.
Alejado de los principales clusters mineros del norte grande, la ciudad de
Curicó es sede principal de esta escuela
de minas, en una zona dominada por
frutales y por la producción de algunos
de los mejores vinos del país.
Sin embargo, a la carrera le ha ido relativamente bien. Creada en el año 2013,
en pleno período de vacas gordas de
la industria minera, la universidad ya
tiene alumnos cursando su tercer año,
con pronósticos promisorios para 2016,
UYI RS VI¾INER TSV REHE IP HIWjRMQS
generalizado que se vive en el mundo y
en la zona norte del país, producto de
la baja de los precios de los metales y la
desaceleración china.
De hecho, para este año la Universidad
de Talca busca crecer en infraestructura para dar cabida a todos los alumnos
QMRIVSWUYIWIKRIWXMQERPPIKEVjRIR
los próximos años. Es por eso que ya
decidieron la construcción de un nuevo
IHM½GMSTEVEPEGEVVIVEHIMRKIRMIVuEHI
minas junto a algunos laboratorios para
los estudiantes, en la misma ciudad de
Curicó.
±%HIQjW XIRIQSW YR GYEHVS QjW
robusto de profesores de la especialidad, en relación a nuestros alumnos. Sólo investigaciones docentes”,
destaca el director de la carrera, PaFPS+SR^jPI^
De acuerdo al académico, los jóvenes
IWXjRIRXVERHSEIWXYHMEVGSRTYRXENIW
GEHEZI^QjWEPXSW7MRMVQjWPINSWIRIP
último proceso de admisión, el primer
matriculado ingresó con 790 puntos,
mientras que el puntaje de corte se situó en los 636 puntos. “Ese es un plus
que aprovechamos para que nuestros
ingenieros civiles sean diferentes”, aseKYVE+SR^jPI^
Respecto a la malla curricular, el director explica que durante el primer año
WIMQTEVXIRFjWMGEQIRXIVEQSWHIQE-
Pablo González es ingeniero militar de
profesión, especializado en explosivos, gestión
de riesgo y operaciones mineras. Hace cuatro
meses asumió la dirección de la Escuela de
Ingeniería Civil de Minas de la Utal.
de lo que se cree en la región, principalmente a través de varios focos de
pequeña minería.
De acuerdo al Anuario de la Minería del
Servicio Nacional de Geología y Minería
(Sernageomin), los principales productos mineros de la zona corresponden a
QMRIVuERSQIXjPMGEXEPIWGSQSGEPM^EW
cuarzo, arena silícea, arcillas, talco, zeolita
y pumicita.
El Atlas de la Minería del Sernageomin
(cuya última edición disponible corresponde al año 2012), da cuenta de 26
MRWXEPEGMSRIWQMRIVEWRSQIXjPMGEWTVMRcipalmente concentrados en la comuna
de Constitución.
“Actualmente tenemos pequeña minería en la región, por lo que como universidad hemos visitado estas mineras, los
que han tenido muy buena disposición.
Es bueno estar en contacto con estas
empresas y nuestro objetivo es apoyarlos en un futuro no muy lejano”, asegura
+SR^jPI^
= IW IR PE QMRIVuE RS QIXjPMGE HSRHI PE 9XEP IWXj TSRMIRHS WYW ½GLEW
Como ejemplo, el académico destaca
que actualmente varios de los alumnos de la universidad se encuentran
VIEPM^ERHS WYW TVjGXMGEW TVSJIWMSREPIW
en Cementos Biobío, cerca de Curicó.
“La idea es apoyarlos para que ellos
(las empresas) puedan mejorar sus
sistemas en cuanto a la extracción”,
complementa.
marzo 85 nme
UNIV UTAL 84-85.indd 85
08-03-16 16:01
Foto: Codelco
Juan Medel:
Toda una
vida en
Codelco
Con 38 años de carrera en la
estatal minera, a fines del 2014
el ejecutivo presentó su renuncia.
Una historia que lo ha convertido
en protagonista de algunos de
los hechos más importantes
de Codelco, como liderar la
división Radomiro Tomic en dos
oportunidades, y darle vida a
Ministro Hales.
Daniela Tapia
M
ientras recorre su paso por Codelco, no duda en agradecer la oportunidad que le ha brindado la vida de pertenecer a la empresa más importante del país. Y más que eso. En
su relato, se destaca su condición de protagonista de algunos
de los hechos más relevantes que han cruzado la historia de
Codelco.
De padres inmigrantes españoles dedicados al comercio y a la
industria, desde pequeño Juan Medel recuerda su etapa escolar en el Instituto Nacional.
“Era buen alumno. También tuve muy buenos profesores que
enseñaban con pasión para que llegáramos a ser los mejores.
En ese tiempo, disfruté mi paso por el colegio. Hasta fui jefe de
curso, esas típicas cosas de ‘cabro’”, dice riendo.
Tras terminar sus estudios secundarios, ingresó a la Universidad
Católica de Chile a estudiar ingeniería civil industrial. Ahí conoció a la que sería su esposa con quien tuvo tres hijos.
“Los años ’70 fueron una época muy convulsionada en Chile.
El toque de queda marcó a la juventud de ese entonces, la
que no podía permanecer ajena a los tiempos que se vivían”,
cuenta Juan Medel.
Su vinculación con la minería se dio años más tarde gracias a
que su suegro trabajaba en la división El Teniente de Codelco.
Ahí realizó su práctica profesional y luego se incorporó a un
programa de entrenamiento ofrecido a los graduados universitarios en el año 1977.
Mientras estaba en la División El Teniente lo invitaron
a par ticipar en el proyecto Radomiro Tomic, su primer
gran desafío, y una apuesta no menor que consistía en
que Codelco desarrollara por primera vez una gran
faena productiva, par tiendo de cero, para así competir
mano a mano con la minería privada.
“En los ‘90 había un boom importante de la minería privada.
El lema, junto a mi equipo de trabajo que tuve que conformar,
era demostrar que una empresa estatal sí podía construir un
gran yacimiento minero, por lo que hicimos un completo plan
de negocios y un modelo de seguridad y rentabilidad, que
GSREPKYREWQSHM½GEGMSRIWTIVHYVELEWXEIPHuEHILS]IRPE
División Radomiro Tomic”, cuenta Juan Medel.
Posteriormente, se incorporó a la casa matriz de la cuprífera
estatal donde ejerció distintos cargos. Después asumió como
WYFKIVIRXIHI(IWEVVSPPS]4PERM½GEGMzR)WXVEXqKMGEIRPEHMZMsión Chuquicamata.
“En ese entonces, Chuqui estaba atravesando por una situación compleja. No tenía un buen plan de desarrollo, por lo que
nme 86 marzo
PERFIL 86-87.indd 86
08-03-16 14:43
Foto: Codelco
mi desafío fue precisamente diseñar una
hoja de ruta para la ‘reactivación’ de esta
faena”, dice.
Tras esta etapa, regresó a la casa matriz
de Codelco donde asumió como gerente de Negocios y gerente Corporativo
de Evaluación de Inversiones y Control
de Proyectos entre los años 2002 y 2008.
“Este fue un reto importante, ya que vislumbrábamos un gran plan de inversiones
que tenía que adoptar la corporación,
porque ya sabíamos que todos sus yacimientos se estaban agotando y había que
hacer proyectos estructurales y de reposición cruciales para mantener el liderazgo
de la cuprífera”, sostiene el ejecutivo.
Ministro Hales,
repitiendo la historia
De ahí se desempeñó como vicepresidente de Servicios Compartidos en
Codelco, un cargo que tenía por objetivo buscar las mejoras internas al interior
de la empresa.
Pero mientras ejercía ese rol, en 2010 la
gerencia de la cuprífera estatal le pidió
liderar el equipo de profesionales para
crear la nueva División Ministro Hales,
el primer gran proyecto estructural de
Codelco.
“Fue un gran desafío 15 años después
de Radomiro Tomic, donde tuve que
conformar un modelo de negocios y
reclutar a profesionales de las distintas
ramas”, cuenta Juan Medel.
Pero dado los problemas que estaba
enfrentando la división Radomiro Tomic, en 2013 el presidente Ejecutivo
de Codelco le solicitó que regresara a
la faena, esta vez como gerente general.
Así, tras 38 años de carrera en la estatal
QMRIVE UYI GEPM½GE GSQS±PSW QINSVIW
HIWYZMHE²E½RIWHIPIPINIGYXMZS
presentó su renuncia.
Pero en su trayectoria no sólo se desempeñó como ejecutivo de la industria minera. Paralelamente, fue relator en programas de pre y postgrado, tanto en la
Universidad de Chile como en la Ponti½GME9RMZIVWMHEH'EXzPMGEHSRHIIWXYZS
10 años entregando sus conocimientos
del rubro.
Hoy por hoy, es director de algunas
compañías y presidente del directorio
de JRI, una de las empresas de ingeniería
más relevantes del país, además de realizar diversas consultorías.
¿Volvería a la minería? Con un tono categórico, Juan Medel dice que tendría que
ser un desafío muy interesante, porque
el ritmo de trabajo es muy demandante
y hay que dedicar mucho tiempo. “Lo
pensaría”, recalca.
Y a propósito, ¿cómo ve el futuro de
la minería? “Hoy soy secretario general
de Voces Mineras, un grupo de opinión
que busca reforzar la identidad minera
de Chile. Nuestro desafío está en poner en el debate distintos temas como
la relación con las comunidades, la productividad y competitividad, entre otros.
Mi invitación es que la gente joven se
involucre en la principal actividad económica del país y que se atreva a desarrollar otros Ministros Hales o Radomiro Tomic.Y dado que el escenario actual
está dominado por el bajo precio del
cobre, creo que debemos ser capaces
de reinventarnos y abrir nuevos caminos para priorizar la baja de los costos e
incrementar la productividad. Es necesaVMSHI½RMVYRERYIZEJSVQEHILEGIVPE
QMRIVuEHIPWMKPS<<-²½REPM^E
38 años alcanzó a estar Juan Medel
HQ&RGHOFRSHUtRGRTXHFDOLÀFD
como “los mejores años de mi vida”.
3UHVHQWyVXUHQXQFLDDÀQHVGHO
2014, cerrando un exitoso ciclo
en la principal empresa del país.
marzo 87 nme
PERFIL 86-87.indd 87
07-03-16 17:44
Foto: Vulco-Weir Minerals
Bombas en la minería:
Con foco en el gigantismo
Desarrollar equipos más gigantes. Esta es una de las prioridades
que tienen los fabricantes de bombas para la industria minera en
materia de innovación, además de aumentar su vida útil con el fin de
transportar mayor cantidad de sólidos, más grandes y más abrasivos.
Daniela Tapia
C
ada día las bombas cobran mayor importancia dentro de
las operaciones mineras, tanto es así que han sido considerados como los verdaderos corazones encargados de la circulación de los componentes líquidos dentro de una faena.
Fue a partir de la Revolución Industrial cuando las bombas
centrífugas se ganaron un espacio importante en este mercado, siendo las más utilizadas, dado su manejo de grandes
caudales tanto de líquidos claros como de pulpas.
Pero a través de los años estos equipos han ido evolucionando
tanto en calidad como en nuevas tecnologías. Es así como la
industria ha trabajado en dos pilares principales como la optimización de la operación y la disminución en las tasas de falla,
incorporándose nuevos diseños de componentes, fabricados
con piezas de caucho, poliuretano y metálicos de alta dureza,
que garantizan la vida útil de las bombas.
Entre éstos, especialistas sostienen que los componentes del
caucho han superado ampliamente a los convencionales en el
ámbito de la pérdida de costos, ya que al ser más livianos se
VIEPM^EYREQERXIRGMzRQjWI½GMIRXIVjTMHE]WIKYVEHIIWXSW
equipos.
Y es que a juicio de Víctor Hugo Fugellie, consultor en esta materia, los materiales, principalmente los que están en contacto
con los concentrados o pulpas, han mejorado considerablemente en los últimos años.
“Antiguamente era oneroso lograr materiales resistentes al poder
abrasivo y al alto grado de acidez de las pulpas. Es así como la calidad del acero inoxidable, que constituye sus partes en contacto
GSRIP¾YMHS ]EWYZI^ PEVIHYGGMzRHIZIPSGMHEHHIJYRGMSREmiento son logros que han permitido conseguir un tiempo de
funcionamiento continuo”, argumenta el profesional.
nme
nme
nm
m 88 ma
m
marzo
rzo
ESP BOMBAS 88-92.indd 88
07-03-16 17:49
acero, chips de bolas y otros en la pulpa
a bombear) y el resto de los elementos
MRXIVRSW IR GEYGLS REXYVEP² E½VQE 6Mcardo Abarca.
El experto también hace hincapié en
que el gigantismo de las bombas hace
prácticamente imposible “colocar un
equipo operando y otro igual al lado listo para entrar en operación cuando el
primero necesita mantención”.
Es por esto que para disminuir los tiempos de parada en equipos únicos (sin
bomba stand by) se ha desarrollado el
cambio rápido del “wet end”, lo que ha
permitido reducir los tiempos de mantención de 16 horas o más a 6-8 horas.
Y si la continuidad operacional se ha
erigido como un foco de atención, la
I½GMIRGME IRIVKqXMGE XEQFMqR WI LE
transformado en un problema crítico
en el funcionamiento de estos equipos.
Un tema que preocupa al rubro si se
considera el alto consumo energético
que demandan. Es así como en el último tiempo se han realizado cambios
HIHMWIySTEVEQINSVEVPEI½GMIRGMELMdráulica de los componentes húmedos
(OGHVDItRSULQFLSDODSXQWDDGHVDUUROODU
ERPEDVFDGDYH]PiVJUDQGHV\FRQPD\RU
WLHPSRGHRSHUDFLyQHQWUHPDQWHQFLRQHV
)RWR9XOFR:HLU0LQHUDOV
Otro aspecto que ha sido relevante a
la hora de disminuir los costos de falla
ha sido la separación de los elementos
estructurales del equipo de bombeo y
los elementos de desgaste.
Pero hoy por hoy, el desafío principal apunta a desarrollar bombas cada
vez más grandes y con mayor tiempo
de operación entre mantenciones. Un
ejemplo de ello es la molienda SAG que
requiere bombas capaces de mover
15000m3/hr y más.
A esto se suma el aumento de la vida
útil de sus componentes. Precisamente, en el circuito de molienda el equipo
más crítico en términos de mantención
es la bomba, ya que tiene los ciclos más
cortos entre mantenciones.
Prueba de ello es que en una planta
concentradora, la detención del circuito de molienda representa un costo de
más de US$ 20.000 por hora, y puede llegar a US$ 50.000 en plantas más
grandes. Para ello, dice Ricardo Abarca,
consultor especializado en bombas para
la minería, hay tres aspectos fundamentales que se deben mejorar: los materiales que están en contacto con la pulpa,
la hidráulica de la bomba y su geometría
interna.
En relación a los materiales, la incorporación de revestimientos de goma en
la molienda SAG ha incrementado la
vida útil, principalmente al desarrollo de
nuevos compuestos de caucho natural
combinados con el diseño de estos elementos.
“El promedio de mantenciones era de 8
a 10 por año, hoy en día gracias a todos
los desarrollos incorporados el promedio es de 4 mantenciones al año”, plantea el especialista.
(ÀFLHQFLDHQHUJpWLFD
XQDSUHRFXSDFLyQFHQWUDO
Ya en el pasado sólo se permitía que
las bombas en el circuito de molienda
fueran 100% metálicas con aleaciones
especiales de alta dureza, pero actualmente la industria minera reconoce que
las bombas con revestimientos elastoméricos entregan una mayor vida útil
que los revestimientos metálicos.
“La mejor combinación es impulsor metálico (dado el contenido de bolas de
marzo 89 nme
ESP BOMBAS 88-92.indd 89
07-03-16 17:49
)RWR)/6PLGWK
de la bomba, tales como impulsores y
revestimientos.
Ejemplo de ello es la implementación
de una tecnología innovadora denominada “Disco Preswirl”. ¿Sus objetivos?
Disminuir la recirculación de pulpa dentro de la bomba con reiterativos ajustes
TEVEEYQIRXEVPEI½GMIRGMEIRIVKqXMGE]
IP ¾YNS EWu GSQS XEQFMqR HMWQMRYMV IP
desgaste dentro de la bomba.
Y es que además de los cambios de
diseños, se utilizan elementos complementarios en la operación que aumenXER PE I½GMIRGME HIP JYRGMSREQMIRXS HI
la bomba. Uno de estos son los “sellos
mecánicos para pulpa”, los cuales no requieren agua para el sellado de la bomba, contribuyendo al ahorro en el conWYQSHIEKYE]XEQFMqRIRIPGSRWYQS
de energía, ya que no es necesario el
equipo de bombeo de agua para realizar este proceso.
±(IRXVSHIPETVjGXMGEXEQFMqRI\MWXIPE
HMWQMRYGMzRHITqVHMHEHITSXIRGMETSV
JVMGGMzR EP HINEV HI YXMPM^EV IQTEUYIXEduras en el armado de la bomba”, indica
Ricardo Abarca.
Otra opinión plantea el consultor Víctor
Hugo Fugellie, para quien las bombas de
pistón membrana presentan consumos
HIIRIVKuEQjWFENSWQIRSVJVIGYIRGME
de mantenimiento y costos menores de
reparación.
A su vez, el acento está puesto en mejorar la hidráulica. Para este propósito
/DHÀFLHQFLDHQHUJpWLFDWDPELpQ
VHKDWUDQVIRUPDGRHQXQSUREOHPD
FUtWLFRHQHOIXQFLRQDPLHQWRGHODV
ERPEDV8QWHPDTXHSUHRFXSDDO
UXEURPLQHURVLVHFRQVLGHUDHODOWR
FRQVXPRHQHUJpWLFRTXHGHPDQGDQ
WI LER HIWEVVSPPEHS WSJX[EVI GSQS IP
Computer Fluid Dynamic (CFD) que simula lo que ocurre dentro de la bomba
en 3D con animación.
“Siempre se debe balancear la resistenGME EP HIWKEWXI GSR PE I½GMIRGME IR PEW
FSQFEWTSVPSUYIEPKYRSWJEFVMGERXIW
LERQSHM½GEHSIP'*(TEVEMRGSVTSVEV
partículas de sólido y poder anticipar lo
que podría ocurrir en cuanto al desgasXI IR JYXYVSW HMWIySW² WIyEPE 6MGEVHS
Abarca.
Y ante la creciente escasez hídrica que
I\TIVMQIRXE PE MRHYWXVME IR IP TEuW PEW
compañías mineras han debido impulsar
como solución el transporte de agua de
mar desde la costa hasta los yacimientos
y operaciones ubicadas varios kilómetros al interior del territorio y a elevadas
altitudes, proceso en el cual las bombas
juegan un rol clave.
9R VIXS UYI PSW JEFVMGERXIW HI IWXSW
equipos tienen resuelto dado el nivel
de avance que tiene la minería local a
nivel mundial, en opinión del especialista
Ricardo Abarca.
De hecho, la bomba metálica más grande del mundo se utilizó primero en
1MRIVE)WGSRHMHE]JYIHIWEVVSPPEHEIR
Australia, mientras que la bomba más
grande del mundo con revestimientos
HI KSQE JYI JEFVMGEHE IR 'LMPI TEVE
Anglo American para la planta de Los
Bronces.
¡5YqZMIRITEVEIPJYXYVS#9REHIPEW
tendencias que continuará acaparando las miradas de la industria es la del
gigantismo, lo que ha obligado al cambio de tamaño de las bombas para
obtener grandes producciones desde
YRTYRXSHIZMWXEHIQE]SVGSR½ER^E
y seguridad.
Otra tendencia mundial que podría ser
incorporada para la minería local es la
integración de la mecatrónica. Un área
UYIETYRXEEMRXIKVEVPEWHMJIVIRXIWHMWciplinas de la ingeniería para entregar
soluciones tecnológicas avanzadas de
monitoreo de condiciones y control de
los equipos.
±)WXS TIVQMXI EHETXEV HMWIyS ] JEbricación para una producción más
IJMGMIRXIEGSVHIEPEWRIGIWMHEHIWHI
la empresa minera”, concluye Víctor
Hugo Fugellie.
nme 90 marzo
ESP BOMBAS 88-92.indd 90
07-03-16 17:49
Avisos.indd 1
07-03-16 15:09
Principales modelos de bombas para minería en Chile
Empresa /
Representante
Modelo
Descarga
(mm)
Capacidad
(m3/h)
Marca
Principal área de aplicación
/ otras características
ACH Equipos
Micro, Mini
Minex, Minette
Minor, Major
Master, Matador
Magnum, Mega
Solid
Salvador, Sandy
Senior
Bravo
50
75
75 - 100
75 - 150
150 - 250
50
75
100
100 - 150
-
Grindex
Grindex
Grindex
Grindex
Grindex
Grindex
Grindex
Grindex
Grindex
Drenaje
Drenaje
Drenaje
Drenaje
Drenaje
Lodos
Lodos
Lodos
Pulpa
Flow Serve
Titan
M
LC
50 - 350
s/i
s/i
3600
10000
8000
TKL
Worthington
Flowserve
Pulpas
Concentrado / Bomba Horizontal
Pulpas / Bomba Horizontal
FLSmidth
MillMAX-e
MillMAX
MillMAX Ultimate Mill Discharge
SlurryMAX
50 - 400
75 - 650
150 - 850
75 - 400
-
FLSmidth
FLSmidth
FLSmidth
FLSmidth
Relaves
Relaves
Relaves
Pulpa
Grundfos
Serie HS
Serie SP
50 -350
s/i
10 -2500
470
Grundfos
Grundfos
Suministro de Agua / Bomba Horizontal
Extracción de aguas subterráneas
ITT Gould Pumps
Goulds 3180
Goulds 5500
Goulds 3196
-
9000
3180
1590
Goulds Pump
Goulds Pump
Goulds Pump
s/i
Relaves
Bomba Centrífuga - Horizontal
Jacol
Eléctricas Serie EL
Hidráulicas Serie HY
Serie DP
80 - 300
100 - 350
80 - 250
30 -900
100 - 1300
30 - 720
Dragflow
Dragflow
Toyo Pumps
Drenaje
Drenaje
Drenaje
KSB Chile
LSA-S
WBC
LCC-M/LCC-R
TBC
LSR
-
14000
13600
3865
18200
9000
KSB/GIW
KSB/GIW
KSB/GIW
KSB/GIW
KSB/GIW
Pulpa
Transporte Relaves
Pulpa
Área Espesadores
Disposición de Relaves, Transporte de Pulpa
Metso
Serie Orion
Serie Thomas
Serie Sala VASA HD
-
2800 - 5000
11000
50 - 2500
Metso
Metso
Metso
Procesamiento Mineral / Bomba Horizontal
Procesamiento Mineral / Bomba Horizontal
Procesamiento Mineral / Bomba Horizontal
Neptuno Pumps
Tipo Turbina (VTP)
Multietapa (HA)
Multietapa (HR)
-
25000
2400
1500
Neptuno
Neptuno
Neptuno
Drenaje / Bomba Vertical
Drenaje / Bomba Vertical
Relaves / Bomba Horizontal
Ruhrpumpen
PS
-
1817
Ruhrpumpen
Bomba Horizontal
Vogt
Serie MD/MDE
Serie P600
Serie PE800
Serie VC
-
800
900
1400
s/i
Vogt
Vogt
Vogt
Vogt
Bomba Horizontal
Bomba Horizontal
Bomba Horizontal
Drenaje / Bomba Vertical
Weir Minerals
Warman AH
Warman MC
Warman AHP/AHPP
Warman GSL
GEHO DHC, DHT
Floway Pumps VMP
Galigher Serie 1000
25 - 450
125 - 750
100 - 450
600 - 1000
s/i
s/i
40 - 300
5000
10225
4550
18000
10 - 300
8000
1480
Weir
Weir
Weir
Weir
Weir
Weir
Weir
Lodos, Pulpa / Bomba Horizontal
Lodos, Pulpa / Bomba Horizontal
Lodos, Pulpa / Bomba Horizontal
Lodos, Pulpa / Bomba Horizontal
Lodos, Pastas / Bomba Horizontal
Bomba Vertical
Bomba Horizontal
Xylem Inc Chile
Serie 2600
Serie 2000
Serie 5000
50 - 150
75 - 250
100 - 200
-
Flygt
Flygt
Flygt
Drenaje / Bomba Vertical
Lodos
Lodos
Fuente: Elaborado en base a la información disponible de cada empresa.
s/i: sin información
nme 92 marzo
ESP BOMBAS 88-92.indd 92
07-03-16 17:49
Avisos.indd 1
07-03-16 15:09
Foto: Eral Chile
Tratamiento de relaves
mediante hidro-escurridores
La implementación de unidades de hidro-escurrido a nivel industrial en la planta
de tratamiento de relaves de Mantos Blancos, como equipos alternativos a los
filtros de banda, permitió un menor coste operativo. Las pruebas piloto que se
desarrollaron directamente en planta entregaron prometedores resultados.
Atilio Astete F.*
Eral-Chile, S.A.
E
l siguiente trabajo aborda la implementación de unidades
de hidro-escurrido a nivel industrial en la planta de tratamiento de relaves de la Minera Mantos Blancos. Estas unidades se
MRWXEPEVSR GSQS IUYMTSW EPXIVREXMZSW E PSW ½PXVSW HI FERHE
reduciéndose la potencia y consecuentemente con un menor
coste operativo.
Esta implementación se sustenta en pruebas piloto realizadas
TVIZMEQIRXIIRPETPERXEPEWGYEPIWHMIVSRTVSQIXIHSVIWVIsultados.
(YVERXI IP TMPSXENI VIEPM^EHS IRXVI PSW EySW ] WI
HI½RMzYRGMVGYMXSHIXVEXEQMIRXSHIVIPEZIWQIHMERXIHSWIXE-
TEWHIGMGPSREHS]YREIXETEHIIWGYVVMHSGSRWYWVIWTIGXMZSW
TEVjQIXVSWSTIVEXMZSW4SVPSXERXSPEMQTPIQIRXEGMzREIWGEPE
industrial debía contemplar similares equipos pero de mayor
capacidad de tratamiento.
Para la primera etapa de ciclonado se mantuvo la batería
KVEZMXEGMSREP HI GMGPSRIW HI QQ QSHM½GjRHSPSW E YRE
GSR½KYVEGMzRQjWEPEVKEHETEVEHMWQMRYMVIPXEQEySHIGSVXIEYQIRXERHSEWuPEJVEGGMzRHIWzPMHSWIRPEHIWGEVKEUYI
alimenta directamente al escurridor.
0SW JMRSW GSRXIRMHSW IR IP VIFSWI HI PSW LMHVSGMGPSRIW
IRQIRSVGERXMHEHWIHIVMZEREPSWIWTIWEHSVIWTEVEWY
nme 94 marzo
ART TEC 94-95.indd 94
08-03-16 16:01
Resultados
A partir de los datos de operación se
pudo establecer la capacidad de trataQMIRXS HIP IWGYVVMHSV IRXVIKERHS YRE
torta con una humedad adecuada para el
XVERWTSVXIIRGMRXEWXVERWTSVXEHSVEWTEVE
la disposición del relave en botaderos.
En la batería de ciclones primaria se obXYZSYR¾YNSHIVIPEZIWHIXL YRE
concentración de sólidos en alimentación
HIYREGSRGIRXVEGMzRHIWzPMHSWIR
VIFSWIHI]YREGSRGIRXVEGMzRHI
sólidos en descarga de 70%.
La batería de ciclones secundaria e
hidro-escurridor arrojó una concentración de sólidos en alimentación de
YREGSRGIRXVEGMzRHIWzPMHSWIR
VIFSWIHIYREGSRGIRXVEGMzRHIWzlidos en descarga escurridor de 70%. El
VITEVXSHIWzPMHSWEPYRHIV¾S[JYIHI
]IP¾YNSHIWzPMHSWIRHIWGEVKE
HIPIWGYVVMHSVHIXL
Instalación de segunda
unidad industrial
(EHSWPSWFYIRSWVIWYPXEHSWSFXIRMHSW
en enero del 2010 se instaló un segun-
HSIWGYVVMHSVUYIHERHSGSR½KYVEHSIP
circuito de la siguiente forma:
Primera etapa de ciclonado: Batería
Gravitacional de ciclones con cuatro
Hidrociclones de poliuretano modelo
PP050102 (500 mm); dos EscurridoVIW:MFVERXIW ): O;\ jVIE
XMP HI ½PXVEHS Q2x2; un Grupo
HI &SQFIS +& GSR FSQFE (110 kW).
Segunda etapa de ciclonado: una
Batería de Hidrociclones modelo
()*+ GSR LMHVSGMGPSRIW
de poliuretano modelo PP010041
(100 mm).
Foto: Eral Chile
espesamiento y posterior confinamiento en el tranque húmedo.
0SW ½RSW TEWERXIW TSV PE QEPPE HIP IWGYVVMHSVQjWIPEKYE½PXVEHEWIVIGSKIR
IR YRE GYFE WMXYEHE FENS IP IWGYVVMHSV
desde donde se bombea la pulpa a una
WIKYRHE IXETE HI LMHVSGMGPSREHS TEVE
IP IWTIWEHS HI PSW ½RSW VIGMVGYPERXIW
los cuales son nuevamente dispuestos
WSFVI PE TVI GETE HIP IWGYVVMHSV TEVE
engrosar la torta resultante.
0E TVMQIVE YRMHEH MRHYWXVMEP MRWXEPEHE
en febrero de 2007 y puesta en serZMGMS IR QEV^S HIP QMWQS EyS GSRtempló los equipos que se describen a
continuación.
Primera etapa de ciclonado: batería
gravitacional de ciclones con dos Hidrociclones de poliuretano modelo
PP050102 (500 mm); un Escurridor
:MFVERXI ): O; jVIE XMP HI
½PXVEHSQ2; un Grupo de Bombeo
+&GSRFSQFEO;
Segunda etapa de ciclonado: una Batería
HI ,MHVSGMGPSRIW QSHIPS ()*+
con 38 hidrociclones de poliuretano
modelo PP010041 (100 mm).
,QFUHPHQWRGHVyOLGRVÀOWUDGRV
mediante Hidro-Escurridores
Se está trabajando en un proyecto de
incremento del repar to de sólidos en
PETVMQIVEIXETEHIGMGPSREHSUYIWI
HIVMZE LEGME PSW LMHVSIWGYVVMHSVIW
para aumentar los relaves a depositar
IRFSXEHIVSIPGYEPGSRWMWXIIRGEQbiar la primera batería de ciclones priQEVMSWTSVIUYMTSWHIQIRSVXEQEyS
QQ TEVE TVSHYGMV YR XEQEyS
HIGSV XIQjW½RS]XVEXEVHIPPIKEVE
YRVITEV XS
Adicionalmente dicha batería será alimentada mediante una bomba cenXVuJYKE TYHMqRHSWI IPIZEV PE TVIWMzR
de alimentación a ciclones y mantener una operación más estable y más
eficiente.
Conclusiones
%PSPEVKSHIRYIZIEySWHISTIVEGMzR
se ha establecido que los Hidro-Escurridores son una alternativa viable para la
½PXVEGMzRHIVIPEZIWIRTPERXEWGSRGIRXVEHSVEWHIXEQEySQIHMSTYHMqRHSWI
tratar en ellos la fracción sobre 30-45
QMGVEW UYI IR QYGLEW TPERXEW VITVIsenta un 60-70% de la masa total de
relaves.
0EJVEGGMzR½REUYIWIHIVMZEEPXERUYI
IWTIWEHSVVITVIWIRXEYRQIRSVVIUYIrimiento de torque en su sistema de
accionamiento.
*Artículo técnico preparado especialmente
para Revista Nueva Minería y Energía por Atilio Astete F., Gerente Comercial de la empresa
Eral Chile.
marzo 95 nme
ART TEC 94-95.indd 95
08-03-16 16:01
ABB participa en proyecto
solar Luz del Norte con
42 transformadores
Un total de 42 transformadores suministró la empresa
%&&EPTEVUYIWSPEV0Y^HIP2SVXITVS]IGXSUYIGSRWXVYye la empresa First Solar en la Región de Atacama y que
TVSQIXI GSRZIVXMVWI IR PE QE]SV MRWXEPEGMzR HI IRIVKuE
solar fotovoltaica (PV) en América Latina.
0E½VQEHIWXEGzUYIWIXVEXEHIXVERWJSVQEHSVIW±VSFYWtos, con buena capacidad de aislamiento y preparados para
operar en un ambiente agresivo”.
Los transformadores fueron sometidos a diversas pruebas
en fábrica para medir variaciones de temperatura del equipo y comprobar su aislamiento, entre otras pruebas.
Se espera que Luz del Norte entre en funcionamiento en
TVSHYGMIRHSIRIVKuEIUYMZEPIRXIEZMZMIRHEW
y al mismo tiempo evitando emisiones de C02 equivalentes
EQjWHIXSRIPEHEWQqXVMGEWTSVEyS
Betapaint destaca cualidades de su producto Rust Grip
'SQS±I\MXSWS²GEPM½GzPEIQTVIWE&IXETEMRXIPEySTVMRGMTEPQIRXITSVPSWFYIRSWVIWYPXEHSW
UYILEXIRMHSWYTVSHYGXS6YWX+VMTYRIRHYVIGIHSVPuUYMHSTEVEXSHSXMTSHIWYTIV½GMIW]HIWXEGEHSTSVPE½VQEGSQSYRE±WSPYGMzR²TEVEPEGSVVSWMzRIRMRHYWXVMEWQMRIVEW]TSVXYEVMEW
“Un solo producto cumple la función de imprimante, coating intermedio y revestimiento de terminaGMzRIZMXERHSXEQFMqRIPXIHMSWSTVSGIWSHIKVEREPPEHS7IETPMGEHMVIGXEQIRXIWSFVIWYTIV½GMIWS\MHEHEWIRXVIKERHSYRXVEFENSHIQE]SVGEPMHEH]KIRIVERHSELSVVSWWMKRM½GEXMZSWXERXSIRMRWYQSW
tiempo y en mano de obra”, destaca la empresa.
Atlas Copco destaca en ranking Global 100
como compañía de maquinaria “más sustentable”
Atlas Copco fue nuevamente reconocida como la empresa de maquinaria “más sustentable del mundo”, según la lista anual conocida
como Global 100, y que fue presentada en el marco del último Foro
Económico Mundial realizado en la localidad de Davos, Suiza.
0EPMWXEUYIGPEWM½GEEPEWIQTVIWEWUYIHIQYIWXVEREYQIRXEVWYTVSductividad utilizando menos recursos, ubica a Atlas Copco en el puesXSRQIVSIRPEGPEWM½GEGMzRKIRIVEP]IWPERMGEGSQTEyuEHIPE
industria de la maquinaria incluida en la lista.
'SR WY YFMGEGMzR IR PE PMWXE HI IWXI EyS PE QYPXMREGMSREP HI SVMKIR
sueco suma su décima aparición en el ranking Global 100.
Atlas Copco también aparece en el Índice de Sustentabilidad Dow
Jones Europa para 2015/2016, y ocupa el puesto número 11 a nivel
mundial en el Newsweek Green Ranking, uno de los rankings más importantes del mundo en materia de sustentabilidad corporativa.
nme 96 marzo
INDUSTRIA 96-104.indd 96
07-03-16 17:48
Avisos.indd 1
07-03-16 15:10
Finning arrienda
equipos para Festival
del Huaso de Olmué
Por cuarto año consecutivo, la empresa Finning participó en la
logística asociada al Festival del Huaso de Olmué arrendando
equipos generadores para este importante espectáculo musical
que se realizó durante enero.
%XVEZqWHIWYHMZMWMzRHIEVVMIRHSW6IRXEP7XSVI'LMPIPE½VQE
suministró 4 equipos de 500kva, sincronizados en paralelo, que
soportan audio, iluminación y video.
Todos estos equipos cuentan con motor electrónico de última
generación C15, de bajas emisiones “por lo que son amigables
con el medio ambiente y cuentan con tarjetas de sincronismo
)EW]+IR²HIWXEGzPE½VQE
Los generadores de Finning también han estado presentes en
otros eventos artísticos, deportivos y televisivos, como los reality
de Canal 13, el Festival de la Canción de Viña del Mar, el Mundial
FIFA sub 17, la Copa Sudamericana 2015 y la Teletón.
Acciona presenta
nuevo vehículo
eléctrico de competición
La multinacional española Acciona presentó
recientemente un nuevo vehículo eléctrico de
competición de categoría 1, que fue diseñado
siguiendo la reglamentación técnica y de seguridad de la Federación Internacional del Automóvil, FIA, y de ASO, organizadora de la carrera
Dakar.
Se trata de la nueva versión del vehículo Acciona 100% EcoPowered, que destaca por ser un
40% más liviano que su predecesor. Cuenta con
un pack de ocho baterías de litio que le dan una
autonomía de más de 200 km en competición
y 300 CV.
El modelo recientemente completó diez etapas del Rally Dakar, lo que equivale al 80% de
la carrera, considerada la prueba off road más
exigente del mundo automovilístico.
El auto tiene como objetivo demostrar la viabilidad y potencial de las energías renovables aún
bajo las condiciones más extremas, ya que es el
RMGSZILuGYPSIPqGXVMGSUYILE½REPM^EHS
una fecha del calendario mundial de rallies, con
su exitosa performance en el Rally Internacional de Marruecos.
Puerto Angamos participa en encuentro
empresarial en Antofagasta y Mejillones
9RERYIZENSVREHEHIPIRGYIRXVSIQTVIWEVMEP±>MGSWYV%WME4EGu½GS²WIVIElizó en la ciudad de Antofagasta, evento que tuvo entre sus participantes a
autoridades nacionales y regionales, además de ejecutivos de diferentes
empresas de Chile y Argentina.
Puerto Angamos fue una de las empresas que participó de las reuniones que se desarrollaron en el marco del evento.
“Nos hemos vuelto a presentar como uno de los principales socios
estratégicos para la industria del norte de Chile y la Zicosur. Las reuniones que se generan en estas jornadas nos permiten dar a conocer
aspectos de nuestra operación y presentarles a otros empresarios
EGIVGE HIP I\MXSWS TPER HI MRZIVWMSRIW VIEPM^EHS HYVERXI IWXI EyS²
destacó el gerente General de Puerto Angamos, Phillip Schaale.
'SQSTEVXIHIPEWEGXMZMHEHIWS½GMEPIWHIGMIVVIHIPIRGYIRXVSYREHIlegación de más de 30 empresarios de Brasil y Argentina visitaron las instalaciones de Puerto Angamos para conocer en terreno la operación del
terminal.
nme 98 marzo
INDUSTRIA 96-104.indd 98
07-03-16 17:48
Avisos.indd 1
08-03-16 11:48
Grupo Liebherr registra
volumen de ventas récord
en el ejercicio 2015
El mayor volumen de ventas en su historia alcanzó
el Grupo Liebherr en el ejercicio 2015, tras sumar
9.248 millones de euros de manera global en el período.
El resultado del ejercicio 2015 supone un incremento de
425 millones de euros en comparación al período anteVMSV PS UYI IUYMZEPI E YR EP^E HI WIKR HIWXEGz PE
compañía.
)RIWXIPXMQSINIVGMGMS0MIFLIVVGVIGMzIRIPjVIEHIQEquinaria de construcción y minería, así como en el área
UYIEFEVGEPEWHMZMWMSRIWHIKVEWQEVuXMQEWXIGRSPSKuEEIroespacial y de transporte, máquinas herramienta y sisteQEW HI EYXSQEXM^EGMzR IPIGXVSHSQqWXMGSW GSQTSRIRXIW
y hoteles.
)PKVYTSXEQFMqRVIKMWXVzYREYQIRXSIRWYHSXEGMzRIP
que se elevó a unos 42.000 trabajadores en todo el mundo,
lo que representa un incremento de 1.080 personas en
comparación con el ejercicio anterior.
Estructuras Domo construye proyecto para Sibelco
Estructuras Domo, empresa de matriz española y recientemente implantada en Chile, participa en la construcción de dos domos
de almacenamiento para Sibelco, empresa multinacional proveedora de minerales industriales no metálicos con diversas aplicaciones industriales.
Los domos, con capacidad para 14.000 m3 de cal viva cada uno, se construyen actualmente en el Centro de Distribución Noviciado de Sibelco, ubicado en la comuna de Lampa.
1MIRXVEWIPTVMQIVHSQSHIPTVS]IGXSWIIRGYIRXVE½REPM^EHSIPWIKYRHSWIIRGYIRXVEIRPEPXMQEJEWIHIWYGSRWXVYGGMzR
El proyecto fue recientemente visitado por ejecutivos de ambas empresas, como el gerente General del Sibelco, Sergio FonseGE]IPTVIWMHIRXIHI)WXVYGXYVEW(SQS.YER%RXSRMS7YjVI^EHIQjWHIEYXSVMHEHIWGSQSIPIQFENEHSVHI&qPKMGEIR'LMPI
Patrik de Beyter; el embajador de España, Carlos Robles; el gerente de Medio Ambiente de Sofofa, Jorge Cáceres; y la alcaldesa
subrogante de Lampa, Ana Karina Soto.
Lureye Electromecánica recibe
visita de su proveedor Delta
La visita de Santiago Dotta, gerente de Ventas para el cono
sur de la empresa proveedora Delta, recibió recientemenXIPEIQTVIWE0YVI]I)PIGXVSQIGjRMGEIRWYWS½GMREWHI
Santiago.
En la oportunidad, el ejecutivo se reunió con el gerente
General de Lureye Electromecánica, Francisco Javier Díaz,
y el gerente de Producto de Lureye, Víctor Romo (los tres
en la foto).
El objetivo de esta visita fue la revisión del año 2015 en relación a los acuerdos realizados anteriormente, además de la
TPERM½GEGMzR]TVS]IGGMSRIWTEVEIP8EQFMqRWIGSRZIVWz
respecto a los canales más oportunos de comunicación para
llegar a los clientes y la continua capacitación del personal.
Lureye distribuye variadores de frecuencia Delta para motores, entregando soluciones en accionamiento electromecánico para todo tipo de industrias.
nme 100 marzo
INDUSTRIA 96-104.indd 100
07-03-16 17:48
Avisos.indd 1
07-03-16 15:17
Nombramientos
Grupo Eulen
Andrés Möller Cantín fue
nombrado recientemente
como nuevo subdirector
General para el cono sur
del Grupo Eulen, cargo que
compatibilizará con su rol
actual de gerente General
del Grupo Eulen Chile.
Con más de 27 años de
trayectoria en el mundo
IQTVIWEVMEPIPINIGYXMZS
se incorporó a la empresa
en 2004 como director
Nacional de Seguridad, y cuenta con estudios
de psicología en la Universidad Uniacc y de
MRKIRMIVuEIRINIGYGMzRIRGSQIVGMEPM^EGMzR]IR
marketing internacional en la Universidad Diego
Portales.
Resiter impulsa campaña
de prevención para trabajadores
de la división Radomiro Tomic
Siemens
Eduardo Gorchs fue
nombrado como
nuevo gerente de
las divisiones Digital
Factory y Process
Industries & Drive, de
Siemens Chile.
)PINIGYXMZSIWMRKIniero electrónico del
ITBA y posee un Executive MBA otorgado
por el IAE Business
School. Cuenta con
una amplia experiencia en mercados de
infraestructura desarrollada en empresas
internacionales como IBM, Sony y Siemens.
Sus distintas asignaciones internacionales lo
han llevado a desempeñarse en Alemania y
QjWVIGMIRXIQIRXIIR:IRI^YIPE
Weir Minerals
Ricardo Garib fue nombrado recientemente
como nuevo director
)NIGYXMZSHIPEHMZMWMzR
Minería del grupo Weir a
RMZIPQYRHMEPGSRS½GMRE
tanto en Melbourne, Australia, como en Santiago.
Ingeniero mecánico de
la Universidad Católica
y con un post grado en
la Escuela de Negocios,
Garib ha liderado las
operaciones de Weir Minerals en LatinoaméVMGEHIWHIWMIRHSTVIZMEQIRXIHMVIGXSV
)NIGYXMZSHI:YPGS7%IR'LMPI
Una campaña de prevención con acento en la seguridad y autocuiHEHSHIPSWXVEFENEHSVIWHIWEVVSPPEPEIQTVIWE6IWMXIVIRPEHMZMWMzR
Radomiro Tomic, de Codelco.
La iniciativa, impulsada por la Gerencia de Seguridad, Salud y Medio
%QFMIRXI771%HI6IWMXIVFYWGEGSRGMIRXM^EVEPSWXVEFENEHSVIW
HIUYIRSLE]QINSVI\TIVXSIRWIKYVMHEH]EYXSGYMHEHSUYIIPPSW
mismos.
4EVE6SRR]'SVRINSKIVIRXIHI771%HI6IWMXIVPEQIXEIWPSKVEV
una integración del operario, pues ellos son los expertos y conocen
PSWVMIWKSWQINSVUYIREHMI±2SUYIVIQSWMRHMGEVUYqLEGIVUYIVIQSWUYIPSWQMWQSWXVEFENEHSVIWRSWGSQYRMUYIRWYWSFWIVZEciones y sugerencias” expresó el directivo.
Siemens logra récord en rendimiento y
HÀFLHQFLDHQFHQWUDOHOpFWULFDDOHPDQD
Una serie de marcas “mundiales” asegura haber logrado la empresa Siemens,
luego de entregar una planta de ciclo combinado en la zona portuaria de
Düsseldorf, Alemania, equipada con una turbina de gas de clase H de Siemens.
La empresa destacó que durante la prueba previa a la aceptación, la unidad
“Fortuna” llegó a alcanzar una generación eléctrica neta máxima de 603,8
megavatios (MW), lo que supone un nuevo récord para una planta de ciclo
GSQFMREHSHIIWXIXMTSGSRYREGSR½KYVEGMzRQSRSINI
Asimismo, la instalación también habría logrado un “récord mundial” al alcan^EVYREI½GMIRGMEHIKIRIVEGMzRHIPEHIQjWHIYRRMZIPHIYXMPM^EGMzR
HIGSQFYWXMFPIHIP
nme 102 marzo
INDUSTRIA 96-104.indd 102
08-03-16 14:47
Avisos.indd 1
07-03-16 15:18
Multi-Wing presenta sus hélices
para estaciones de compresión a gas
Nombramientos
Vulco
Un nuevo gerente General tiene desde enero
la empresa Vulco S.A.,
tras la nominación de
Oscar Bauer. Vinculado
EPE½VQEHIWHI
el ejecutivo ha tenido
diferentes responsabilidades tanto en el
área de costos, ventas, y
operaciones de la compañía, además de Vulco
Perú, donde también se
desempeñó como gerente General.
Bauer estudió ingeniería de minas en la
Universidad de Chile, y tiene un diplomado
en ventas en la misma Universidad y otro
diplomado en administración en la Universidad Católica del Norte.
JRI
El ex ejecutivo de
Codelco, Juan Medel, fue nombrado
como nuevo presidente del directorio de la empresa
consultora JRI.
Medel, quien
formaba par te de
la mesa directiva
de JRI desde mayo
HIXYZS
una destacada trayectoria de casi cuatro
décadas en Codelco, donde se desempeñó
como gerente general de las divisiones
Radomiro Tomic y Ministro Hales; vicepresidente de Ser vicios Compar tidos; gerente
Corporativo de Inversiones, y gerente de
Planificación de la división Chuquicamata,
entre otros cargos.
Quant
'SRQjWHIEySWHI
experiencia, principalmente en el mercado minero,
Maximiliano Aqueveque, fue
nombrado como vicepresidente Senior y gerente Regional de la empresa Quant
para Sudamérica, cargo que
S½GMEFEHIJSVQEMRXIVMRE
HIWHIEKSWXSHI
Desde su nuevo cargo, el
ejecutivo espera alcanzar
este año un crecimiento
IRzVHIRIWHIPGSRVIWTIGXSEPIR
tres países prioritarios para la compañía: Brasil,
Argentina y Chile.
La empresa MultiWing ha desarrollado, para sus hélices
utilizadas en ambientes con atmósfera explosiva, un
TIV½P HI TEPE + ]
material en PAGAS
(ATEX) cuyo bene½GMSHMVIGXSWIETPMGE
para diversos requerimientos.
Este producto se puede utilizar en enfriadores para estaciones de compresión de gas, radiadores o
MRXIVGEQFMEHSVIW]IRHI½RMXMZEIRGYEPUYMIVTYRXSHIXVEFENSHSRHIIWXqTVIsente una atmósfera explosiva.
Actualmente para cubrir estas necesidades del mercado, la empresa dispone
de hélices con una gran amplitud en rangos de diámetro, que van desde los
QQLEWXEPSWQQ9RSHIWYWTVS]IGXSWQjWEQFMGMSWSWHYVERXI
IPEySJYIPEVIJVMKIVEGMzRHIPKEWSHYGXSHI+E^TVSQIR6YWME
QEVGERHSTVIWIRGMEGSRPELqPMGI+4%+%7IRXSHSWPSWXVEQSWHIGSQpresión de gas.
Ejecutivos de Mincon visitan
instalaciones de la empresa en Chile
Una delegación de ejecutivos de la compañía Mincon visitó recientemente
Chile para conocer en terreno el
funcionamiento y operación de
las instalaciones de la empresa
en Santiago.
La visita fue encabezada por
IPGLEMVQERHIPE½VQEIPMVlandés Peter Lynch, y por el
gerente de marketing global,
el canadiense Bob Fassl, quienes fueron recibidos en Santiago por el gerente General
de Mincon Chile, Patricio Lagarini
(los tres en la foto).
Con productos y servicios destinados
principalmente a sectores como minería y
obras civiles, Mincon busca fortalecer su presencia en estas industrias, principalmente entre las compañías mandantes y sus contratistas, en áreas como perforación, producción y exploración.
nme 104 marzo
INDUSTRIA 96-104.indd 104
07-03-16 17:49
Avisos.indd 1
07-03-16 15:18
Precios diarios del cobre - febrero 2016
(BML)
Día
Precio (¢/lb)
1 febrero
205,659
2 febrero
208,902
3 febrero
207,677
4 febrero
212,508
5 febrero
211,782
8 febrero
207,405
9 febrero
205,500
10 febrero
204,434
11 febrero
202,937
12 febrero
203,595
15 febrero
206,929
16 febrero
207,904
214
17 febrero
206,929
212
18 febrero
207,609
210
19 febrero
208,199
22 febrero
213,007
23 febrero
211,533
24 febrero
207,995
204
25 febrero
211,147
202
26 febrero
212,327
29 febrero
213,415
Evolución diaria precio nominal cobre (c/Ib - BML)
del 01 al 29 de febrero de 2016
Precio
216
208
206
200
01/02/16
04/02/16
09/02/16
12/02/16
17/02/16
22/02/16
25/02/16
Fuente: Cochilco
Promedios mensuales del cobre 2012 - 2016 (BML)
2012
2013
2014
2015
2016
Enero
364,845
365,109
330,891
263,802
202,427
Febrero
382,047
367,071
324,416
258,642
208,447
Marzo
383,605
347,584
302,448
268,792
Abril
374,651
326,739
302,584
273,447
Mayo
359,242
327,910
312,248
285,791
Junio
336,570
317,699
308,719
264,608
Julio
344,249
312,660
322,255
247,521
Agosto
339,852
325,782
317,540
230,830
Septiembre
365,975
324,837
311,719
236,235
Octubre
366,027
325,791
305,486
236,894
Noviembre
349,003
320,527
303,958
218,098
Diciembre
361,177
326,720
291,340
209,968
Promedio anual 360,593
332,120
311,255 249,226
213,415
Mayor precio del mes
(29 febrero)
202,937
Menor precio del mes
(11 febrero)
208,447
205,511*
Promedio mensual
febrero
Fuente: Cochilco
* Promedio al 29 de febrero.
nme 106 marzo
CIFRAS 106-107.indd 106
08-03-16 15:21
Precios diarios del oro - febrero 2016
Evolución diaria precio nominal oro (US$/ozt - BML)
(BML)
del 01 al 29 de febrero de 2016
Precio (¢/lb)
1 febrero
1.122,00
2 febrero
1.123,60
3 febrero
1.130,00
4 febrero
1.146,25
5 febrero
1.158,50
8 febrero
1.173,40
9 febrero
1.188,90
10 febrero
1.183,40
11 febrero
1.223,25
12 febrero
1.239,50
15 febrero
1.208,45
16 febrero
1.212,00
17 febrero
1.202,40
18 febrero
1.204,40
19 febrero
1.221,50
22 febrero
1.203,65
23 febrero
1.218,75
24 febrero
1.232,25
25 febrero
1.235,40
26 febrero
1.231,00
29 febrero
1.234,15
1260
1240
1220
1200
Precio
Día
1180
1160
1140
1120
1100
01/02/16
04/02/16
09/02/16
22/02/16
25/02/16
Mayor precio del mes
(12 febrero)
1.122,00
Menor precio del mes
(1 febrero)
1.194,89
Promedio mensual febrero
Promedios mensuales del oro 2012 - 2016 (BML)
2013
17/02/16
1.239,50
Fuente: Cochilco
2012
12/02/16
2014
2015
2016
Enero
1.656,10
1.671,89
1.243,07
1.249,33
1.095,66
Febrero
1.743,10
1.630,69
1.298,71
1.231,10
1.194,89
Marzo
1.675,06
1.591,01
1.336,56
1.180,64
Abril
1.648,54
1.485,90
1.299,18
1.198,25
Mayo
1.585,11
1.416,14
1.288,91
1.197,68
Junio
1.595,63
1.342,70
1.277,86
1.182,25
Julio
1.592,78
1.284,35
1.312,99
1.131,61
Agosto
1.625,68
1.345,05
1.297,01
1.117,51
Septiembre
1.741,93
1.348,46
1.241,33
1.124,90
Octubre
1.746,35
1.311,81
1.225,85
1.157,61
Noviembre
1.724,35
1.277,42
1.176,41
1.090,54
Diciembre
1.687,34
1.221,59
1.200,44
1.068,32
Promedio anual 1.668,86 1.409,51 1.266,06 1.159,82 1.146,48*
Fuente: Cochilco
* Promedio al 29 de febrero.
marzo 107 nme
CIFRAS 106-107.indd 107
08-03-16 15:21
Aprimin organiza mesa redonda sobre
sustentabilidad en la minería
01
Ejecutivos mineros y representantes de consultoras vinculadas con temas ambientales y de responsabilidad social participaron en una mesa redonda organizada
por la Asociación de Proveedores Industriales de la Minería, Aprimin. El impacto
de la sustentabilidad en el negocio minero y el rol de las empresas proveedoras
en estos temas marcaron el debate.
Foto: Felipe Pinto
01: El encuentro organizado
por Aprimin incluyó un
panel de debate, donde
intervinieron Javier Cox,
de Acción RSE; Ana
Zúñiga, de Minera Sierra
Gorda; Ignacio Larraechea,
de Acción RSE; Joaquín
Villarino, del Consejo
Minero, y Juan Pablo
6FKDHͿHUGH&ROE~Q
(todos en la foto, de
izquierda a derecha).
02: Javier Cox y Pascual Veiga
03: Fernanda Mira,
Miguel Ángel Diez y
Alejandra Arenas.
04: Matías Hernández
y Javier Núñez.
05: Alicia Contador,
Alejandra González y
Soledad Sánchez.
06: Ana Zúñiga y Jorge Lagos.
07: Martín Brenner y
Claudio Maturana.
08: Enrique Louit y
Miguel Cuevas.
09: Pascual Veiga,
Karin Eggers,
Juan Carlos Olivares y
Susana Torres.
02
03
04
05
06
07
08
09
nme 108 marzo
SOCIALES 108-109.indd 108
08-03-16 16:02
01
Consejo Minero organiza masivo encuentro
con foco en la productividad
El Consejo Minero cambió su tradicional cena anual por un masivo desayuno que
se realizó en Santiago, con cerca de 800 invitados. El encuentro, que reunió a los
principales actores de la industria minera, puso el acento en la productividad y en
el crecimiento, dos conceptos que han estado muy presentes en el sector en los
últimos meses.
02
03
04
05
06
07
08
09
Fotos: Iván Rodríguez
01: El formato del encuentro
incluyó dos charlas de
apertura, a cargo de
Guillermo Tagle, presidente
de Icare, y Joaquín Villarino,
titular del Consejo Minero,
además de una conferencia
del ministro de Hacienda,
Rodrigo Valdés.
02: El encuentro también
incluyó un panel de
conversación con
representantes gremiales,
sindicales y expertos
consultores.
03: El presidente del Consejo
Minero, Joaquín Villarino,
el ministro de Hacienda,
Rodrigo Valdés, y el
presidente del directorio de
Icare, Guillermo Tagle.
04: Xavier Sala i Martin,
académico de la Universidad
de Columbia; Joseph Ramos,
de la Comisión Asesora
Presidencial de
Productividad; Andrés
Santa Cruz, de la CPC;
Bárbara Figueroa, de la
CUT, y Eugenio Tironi,
de Tironi y Asociados.
05: El presidente del
directorio de Codelco,
Óscar Landerretche, sostiene
el reconocimiento entregado
a la empresa por el Consejo
Minero. Lo acompaña la
ministra de Minería,
Aurora Williams.
06: Gonzalo Rojo,
Francisco Matte y
Álvaro Covarruvias.
07: Jorge Riesco, Mauro Valdés
y Pedro Damanjanic.
08: Tomás Morel, Felipe Purcell,
Luis Contreras y
Juan Somavia.
09: Christian Schnettler,
Ana María Villarreal,
Francisco Espinoza y
Christian Vidal.
marzo 109 nme
SOCIALES 108-109.indd 109
08-03-16 16:02
Avisos.indd 1
08-03-16 11:47
Agenda 2016
MARZO 2016
Seminario Internacional de
Excelencia Operacional en
Minería, Minexcellence 2016
Fecha
: 30 de marzo al 1 de abril
Lugar
: Hotel Hyatt, Santiago
Organiza : Gecamin
Contacto :
minexcellence@gecamin.com
III Seminario de Proveedores
Mineros
Fecha
Lugar
: 5 de abril
: Sede Fundación Chile,
Santiago
Organiza : Cesco y Fundación
Chile
Contacto :
claudia.herrera@cesco.cl
ABRIL 2016
XX Cena Cesco
IX Foro Internacional de
Exploración
Fecha
Lugar
: 4 abril
: Hotel Sheraton,
Santiago
Organiza : Cesco
Contacto : cesco@cesco.cl
15° Conferencia
Mundial del Cobre CRU
Fecha
Lugar
: 4 al 6 de abril
: Hotel Hyatt,
Santiago
Organiza : CRU
Contacto :
conferences@crugroup.com
Congreso Nacional de
Estudiantes de Minería,
Metalurgia y Materiales,
Conem 2016
Fecha
Lugar
: 4 al 7 de abril
: Universidad Técnica
Federico Santa María,
Valparaíso
Organiza : Universidad Técnica
Federico Santa María
Contacto : conem3@usm.cl
USM, Valparaíso
Fecha
: 6 de abril
Lugar
: Club Hípico, Santiago
Organiza : Cesco
Contacto :
claudia.herrera@cesco.cl
Bauma 2016
Fecha
Lugar
Organiza
Contacto
:
:
:
:
11 al 17 de abril
Múnich, Alemania
Camchal
fwagner@camchal.cl
XI Conferencia Internacional
de Minería, Chihuahua 2016
Fecha
Lugar
: 13 al 15 de abril
: Centro de Convenciones
y Exposiciones,
Chihuahua. México
Organiza : AIMMGM
Contacto :
info@chihuahuaminero.com
Conminutek
V Seminario Internacional Litio
en la Región de Sudamérica
Fecha
: 6 y 7 de abril
Lugar
: Jujuy, Argentina
Organiza : Panorama Minero
Contacto :
ffraga@panorama-minero.com
9° Expominas Maquinaria
Pesada y Construcción 2016
Fecha
Lugar
Organiza
Contacto
:
:
:
:
6 al 8 de abril
Quito, Ecuador
Hj Becdach Ferias
info@hjbecdach.com
Fecha
Lugar
: 14 de abril
: Hotel Radison Petra
La Dehesa, Santiago
Organiza : Fuente Minera
Contacto :
isabel.espinosa@fuenteminera.com
Seminario “Recursos, Reservas
y Planes Mineros”
Fecha
: 14 de abril
Lugar
: Santiago
Organiza : Comisión Minera
Contacto :
gladys.hernandez@comisionminera.cl
International Comminution
Symposium 2016
VIII Congreso de Correas
Transportadoras, Belt 2016
Fecha
Lugar
Fecha
Lugar
: 11 al 14 de abril
: Hotel Vineyard, Ciudad
del Cabo, Sudáfrica
Organiza : MEI Conferences
Contacto : bwills@min-eng.com
Jujuy, Argentina
: 14 y 15 de abril
: Hotel del Mar,
Viña del Mar
Organiza : Edoctum
Contacto :
paulina.reydet@edoctum.cl
Viña del Mar
marzo 111 nme
AGENDA 111-112.indd 111
08-03-16 15:55
Seminario “Las ERNC en Chile
-Experiencia y desempeño a 8
años de la Ley 20.257”
Fecha
Lugar
: 18 de abril
: Hotel Intercontinental,
Santiago
Organiza : Revista Nueva Minería y
Energía / CTG Energía
Contacto :
contacto@nuevamineria.com
Expomin 2016
Fecha
Lugar
Organiza
Contacto
:
:
:
:
25 al 29 de abril
Espacio Riesco, Santiago
Fisa
ruribe@fisa.cl
CEO Summit
Fecha
Lugar
Organiza
Contacto
:
:
:
:
25 de abril
Espacio Riesco, Santiago
Fisa
ruribe@fisa.cl
VII Seminario Competitividad
en la Minería de las Américas
Fecha
Lugar
: 25 de abril
: Espacio Riesco,
Santiago
Organiza : Sonami / Fisa
Contacto : ruribe@fisa.cl
II Seminario Futuro del
Abastecimiento en Minería
II Seminario Agua de Mar
para la Minería
Fecha
Lugar
Organiza
Contacto
:
:
:
:
26 de abril
Espacio Riesco, Santiago
Fisa
ruribe@fisa.cl
Índice de Avisadores
ABB ..........................................................................Tapa2
Ameco .......................................................................... 39
AR Energía Chile .........................................................55
Seminario Políticas Públicas en
el Sector Minero
Atlas Copco ..........................................................Tapa4
Fecha
: 26 de abril
Lugar
: Espacio Riesco, Santiago
Organiza : Ministerio de Minería /
Fisa
Contacto : ruribe@fisa.cl
BFS................................................................................. 29
IV Workshop Internacional
Codelco Innovación en la
Minería
CRU ............................................................................... 32
Fecha
Lugar
Organiza
Contacto
:
:
:
:
27 de abril
Espacio Riesco, Santiago
Codelco / Fisa
ruribe@fisa.cl
Boart Longyear........................................................... 25
Carrera Solar Atacama ............................................. 99
Cigré ............................................................................110
Comisión Minera ....................................................... 99
CTG Energía...............................................................101
Doosan Bobcat ...........................................................51
DSI Underground ....................................Tapa Interior
Dust-A-Side .................................................................. 17
Edgewell Personal Care Chile SpA ........................51
Edoctum .....................................................................101
IV Workshop Internacional
Recuperación de Metales
desde Residuos Mineros
Fecha
Lugar
Organiza
Contacto
:
:
:
:
27 de abril
Espacio Riesco, Santiago
Fisa
ruribe@fisa.cl
Eecol Electric .............................................................. 59
Ensival Moret .............................................................. 93
Expo Mina Perú ........................................................ 105
Expomin Congreso ................................................. 103
Fuente Minera ...........................................................110
Gasco ........................................................................... 29
Gecamin ................................................................ 79-97
: 26 de abril
: Espacio Riesco,
Santiago
Organiza : Fisa
Contacto : ruribe@fisa.cl
Seminario Productividad
en Minería
Fecha
Lugar
Organiza
Contacto
Jacol ..............................................................................91
III Seminario
Tendencias Sustentables
II Seminario Fundición Refinería: Productividad
y Valor Agregado
Fecha
Lugar
Fecha
Lugar
: 26 de abril
: Espacio Riesco,
Santiago
Organiza : Fisa
Contacto : ruribe@fisa.cl
:
:
:
:
27 de abril
Espacio Riesco, Santiago
Fisa
ruribe@fisa.cl
Intronica ........................................................................21
JLG .................................................................................13
JoyGlobal ....................................................................... 1
Klüber Lubrication Chile .......................................... 43
Fecha
Lugar
Organiza
Contacto
:
:
:
:
28 de abril
Espacio Riesco, Santiago
Fisa
ruribe@fisa.cl
KSB .................................................................................79
Lureye ............................................................................53
Mincon ......................................................................... 23
MIQ Logistics .............................................................. 63
Moly-Cop......................................................................35
Multi-Wing ....................................................................55
MWH Chile ...................................................................67
Hotel Intercontinental,
Santiago
Espacio Riesco, Santiago
Parque Empresarial Zofri Alto Hospicio ............... 45
Prodinsa ........................................................................15
Proseal .......................................................................... 83
Revista Nueva Minería y Energía...............................4
RUD ............................................................................... 39
Sandvik ...................................................................Tapa3
Simposio Oro Perú.....................................................75
Soltex .............................................................................27
Universidad Católica de Valparaíso........................ 71
Ventec ...........................................................................81
Vulco Weir Minerals .....................................................2
nme 112 marzo
AGENDA 111-112.indd 112
08-03-16 17:35
Avisos.indd 1
07-03-16 14:48
Avisos.indd 1
07-03-16 14:48